SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030725E6_E07_e533_09.seq
         (1573 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8BRM9 Cluster: 10 days neonate cortex cDNA, RIKEN full...    41   0.078

>UniRef50_Q8BRM9 Cluster: 10 days neonate cortex cDNA, RIKEN
           full-length enriched library, clone:A830049M19
           product:similar to death effector domain-containing and
           DNA-binding protein 2, full insert sequence; n=1; Mus
           musculus|Rep: 10 days neonate cortex cDNA, RIKEN
           full-length enriched library, clone:A830049M19
           product:similar to death effector domain-containing and
           DNA-binding protein 2, full insert sequence - Mus
           musculus (Mouse)
          Length = 168

 Score = 41.1 bits (92), Expect = 0.078
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = -2

Query: 855 QRDXAGKASTLRKASGPPLCPWXILSSTRSCSAWT-SKLETNIPPCHIKFNCXS 697
           Q D  G+A+ +    GP LC W + SS++SC  WT S   T + PC   F   S
Sbjct: 116 QLDVFGQATAVPAVKGPGLC-WCVTSSSQSCPIWTPSGATTRVAPCCRPFGACS 168


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,190,407,732
Number of Sequences: 1657284
Number of extensions: 21587212
Number of successful extensions: 37304
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 34192
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37067
length of database: 575,637,011
effective HSP length: 104
effective length of database: 403,279,475
effective search space used: 168974100025
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -