Samia BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030725E6_E07_e533_09.seq
         (1573 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_4520| Best HMM Match : Tsg (HMM E-Value=7.8)                        31   1.9  

>SB_4520| Best HMM Match : Tsg (HMM E-Value=7.8)
          Length = 594

 Score = 31.5 bits (68), Expect = 1.9
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = +1

Query: 754 PCRATSCRR*NXPRT-EWRARSLPKGRGLAGXVTLXLCIAPP 876
           P + TSCR+ +  RT  W   + P+G G +  + L L   PP
Sbjct: 46  PLQRTSCRQGHRQRTFRWSHATTPRGGGTSSVLALNLAHVPP 87


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,858,899
Number of Sequences: 59808
Number of extensions: 658169
Number of successful extensions: 931
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 837
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 930
length of database: 16,821,457
effective HSP length: 85
effective length of database: 11,737,777
effective search space used: 5141146326
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)