BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 030725E6_E07_e533_09.seq
(1573 letters)
Database: nematostella
59,808 sequences; 16,821,457 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SB_4520| Best HMM Match : Tsg (HMM E-Value=7.8) 31 1.9
>SB_4520| Best HMM Match : Tsg (HMM E-Value=7.8)
Length = 594
Score = 31.5 bits (68), Expect = 1.9
Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
Frame = +1
Query: 754 PCRATSCRR*NXPRT-EWRARSLPKGRGLAGXVTLXLCIAPP 876
P + TSCR+ + RT W + P+G G + + L L PP
Sbjct: 46 PLQRTSCRQGHRQRTFRWSHATTPRGGGTSSVLALNLAHVPP 87
Database: nematostella
Posted date: Oct 22, 2007 1:22 PM
Number of letters in database: 16,821,457
Number of sequences in database: 59,808
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,858,899
Number of Sequences: 59808
Number of extensions: 658169
Number of successful extensions: 931
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 837
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 930
length of database: 16,821,457
effective HSP length: 85
effective length of database: 11,737,777
effective search space used: 5141146326
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -