BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_E06_e525_10.seq (1562 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0752 - 10922456-10922644,10922719-10922796,10922888-109230... 31 1.9 07_03_1554 + 27659995-27660093,27661084-27661120,27661204-276612... 29 10.0 >03_02_0752 - 10922456-10922644,10922719-10922796,10922888-10923016, 10923105-10923152,10923243-10923333,10923517-10923648, 10923869-10924086,10925121-10925271,10925360-10926009, 10926715-10926786,10926938-10926985,10927105-10927242, 10927750-10927756,10928064-10928212 Length = 699 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +3 Query: 138 LFCRRXFKYXCFLHRLQAXXPRPNLXKXKGPDLKPXXEPCGPXXYM 275 LFCRR + C LH P+ + G +L PCG Y+ Sbjct: 92 LFCRRCLVFDCRLHGCSQNLVFPSEKQPYGHELDENKRPCGDQCYL 137 >07_03_1554 + 27659995-27660093,27661084-27661120,27661204-27661280, 27662272-27662342,27662512-27662590,27662726-27662828, 27662963-27663082,27663180-27663257,27663416-27663471, 27663588-27663657,27664179-27664266,27664503-27664800, 27664943-27665158,27665521-27665841,27666054-27666103, 27666493-27666553,27666633-27666716,27666926-27667039, 27667134-27667300,27667559-27667628,27668328-27668507, 27668619-27668807 Length = 875 Score = 29.1 bits (62), Expect = 10.0 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -2 Query: 292 RKPSRSMXQXGPXGSXXG---FRSGPFXLXKLGLGWXACKR 179 R+ + Q G S G F+SGP + G+GW + K+ Sbjct: 14 RQQQQQQQQRGGAASASGNAVFKSGPLFISSKGIGWKSWKK 54 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,590,972 Number of Sequences: 37544 Number of extensions: 102537 Number of successful extensions: 164 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5046916980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -