BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_E03_e501_09.seq (1519 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23483| Best HMM Match : Glyco_hydro_38C (HMM E-Value=0) 72 1e-12 SB_40313| Best HMM Match : Glyco_hydro_38 (HMM E-Value=0) 72 1e-12 >SB_23483| Best HMM Match : Glyco_hydro_38C (HMM E-Value=0) Length = 965 Score = 72.1 bits (169), Expect = 1e-12 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +2 Query: 212 LNVHXVPHTHDDVGWLKTVDQYYYGSNNXIQKXGVXDILD 331 L +H VPHTHDDVGWLKTVD+Y+YG+NN IQ GV ILD Sbjct: 40 LQIHIVPHTHDDVGWLKTVDEYFYGANNSIQHAGVQYILD 79 >SB_40313| Best HMM Match : Glyco_hydro_38 (HMM E-Value=0) Length = 887 Score = 72.1 bits (169), Expect = 1e-12 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +2 Query: 212 LNVHXVPHTHDDVGWLKTVDQYYYGSNNXIQKXGVXDILD 331 L +H VPHTHDDVGWLKTVD+Y+YG+NN IQ GV ILD Sbjct: 40 LQIHIVPHTHDDVGWLKTVDEYFYGANNSIQHAGVQYILD 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,214,306 Number of Sequences: 59808 Number of extensions: 245387 Number of successful extensions: 410 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4929866340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -