BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_E01_e485_09.seq (1480 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 7e-23 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 6e-22 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 99 8e-21 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 99 8e-21 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 99 8e-21 SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 4e-12 SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_3376| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_35241| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) 63 6e-10 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 62 1e-09 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_9986| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 61 3e-09 SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) 60 3e-09 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 4e-09 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 60 4e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 4e-09 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 60 6e-09 SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) 59 1e-08 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 1e-08 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 59 1e-08 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) 58 1e-08 SB_37193| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 58 1e-08 SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) 58 1e-08 SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) 58 2e-08 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-08 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 58 2e-08 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-08 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-08 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-08 SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) 58 2e-08 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 58 2e-08 SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-08 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 3e-08 SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) 57 3e-08 SB_42228| Best HMM Match : Moricin (HMM E-Value=6.6) 57 3e-08 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) 57 4e-08 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 57 4e-08 SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) 57 4e-08 SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) 57 4e-08 SB_41709| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) 57 4e-08 SB_26951| Best HMM Match : CUB (HMM E-Value=0) 57 4e-08 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 57 4e-08 SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) 57 4e-08 SB_39908| Best HMM Match : Prismane (HMM E-Value=3) 57 4e-08 SB_37382| Best HMM Match : Pkinase (HMM E-Value=1e-04) 57 4e-08 SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) 57 4e-08 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_5886| Best HMM Match : DUF1205 (HMM E-Value=5.9) 57 4e-08 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 56 5e-08 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 56 7e-08 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 56 1e-07 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-07 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-07 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 56 1e-07 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 56 1e-07 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-07 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 56 1e-07 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 56 1e-07 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 55 1e-07 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 55 1e-07 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 55 1e-07 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 55 1e-07 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 55 1e-07 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 55 1e-07 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 55 1e-07 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 55 1e-07 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 55 1e-07 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 55 1e-07 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 55 1e-07 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 55 1e-07 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 55 1e-07 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 55 1e-07 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 55 1e-07 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 55 1e-07 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 55 1e-07 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 55 1e-07 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 55 1e-07 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 55 1e-07 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 55 1e-07 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 55 1e-07 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 55 1e-07 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 55 1e-07 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 55 1e-07 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 55 1e-07 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 55 1e-07 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 55 1e-07 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 55 1e-07 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 55 1e-07 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 55 1e-07 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 55 1e-07 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 55 1e-07 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 55 1e-07 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 55 1e-07 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 55 1e-07 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 55 1e-07 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 55 1e-07 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 55 1e-07 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 55 1e-07 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 55 1e-07 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 55 1e-07 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 55 1e-07 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 55 1e-07 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 55 1e-07 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 55 1e-07 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 55 1e-07 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 55 1e-07 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 55 1e-07 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 55 1e-07 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 55 1e-07 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 55 1e-07 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 55 1e-07 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 55 1e-07 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 55 1e-07 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 55 1e-07 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 55 1e-07 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 55 1e-07 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 85.8 bits (203), Expect(2) = 7e-23 Identities = 39/60 (65%), Positives = 45/60 (75%) Frame = +3 Query: 135 PSVRKTHCTGRKHKDNVKFYYQKWMEEQAQHLIDATTAAFKAGKIAQNPFGTKGASIPPP 314 PSVRKTH GRKHK+NV+FYYQKWMEEQAQ LID TTAAF++ +Q P +PPP Sbjct: 160 PSVRKTHNNGRKHKENVRFYYQKWMEEQAQTLIDQTTAAFQSKPNSQMPPNAPPGLMPPP 219 Score = 40.7 bits (91), Expect(2) = 7e-23 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +3 Query: 90 KYYCDYCDTYLTHDSPSV 143 +YYCDYCDT+LTHDS S+ Sbjct: 111 RYYCDYCDTFLTHDSNSL 128 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 102 bits (245), Expect = 6e-22 Identities = 47/53 (88%), Positives = 47/53 (88%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPVNCNTTHYRANW 842 E RSVRA SLLRQLAKGGCAARRLSW GF SHDVVKRRPVNCNTTHYRANW Sbjct: 28 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 99.1 bits (236), Expect = 8e-21 Identities = 47/53 (88%), Positives = 47/53 (88%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPVNCNTTHYRANW 842 E RSVRA SLLRQLAKGGCAARRLSW GF SHDVVKRRPVNCNTTHYRANW Sbjct: 599 EGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 99.1 bits (236), Expect = 8e-21 Identities = 47/53 (88%), Positives = 47/53 (88%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPVNCNTTHYRANW 842 E RSVRA SLLRQLAKGGCAARRLSW GF SHDVVKRRPVNCNTTHYRANW Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 99.1 bits (236), Expect = 8e-21 Identities = 47/53 (88%), Positives = 47/53 (88%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPVNCNTTHYRANW 842 E RSVRA SLLRQLAKGGCAARRLSW GF SHDVVKRRPVNCNTTHYRANW Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 70.9 bits (166), Expect = 2e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 1041 AXNLPFAIRLRNCWXGDRCGPFRYYASWRKGDVLQGD 931 A + PF RLRNCW GDRCGP RYYASWRKGDVLQGD Sbjct: 30 ASHSPF--RLRNCWEGDRCGPLRYYASWRKGDVLQGD 64 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 70.1 bits (164), Expect = 4e-12 Identities = 36/42 (85%), Positives = 36/42 (85%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPV 875 E RSVRA SLLRQLAKGGCAARRLSW GF SHDVVKRRPV Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPV 67 >SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 65.7 bits (153), Expect = 9e-11 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -2 Query: 1041 AXNLPFAIRLRNCWXGDRCGPFRYYASWRKGDVLQGD 931 A + PF RLRNC GDRCGP RYYASWRKGDVLQGD Sbjct: 2 ASHSPF--RLRNCGKGDRCGPLRYYASWRKGDVLQGD 36 >SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 65.7 bits (153), Expect = 9e-11 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -2 Query: 1041 AXNLPFAIRLRNCWXGDRCGPFRYYASWRKGDVLQGD 931 A + PF RLRNC GDRCGP RYYASWRKGDVLQGD Sbjct: 2 ASHSPF--RLRNCGKGDRCGPLRYYASWRKGDVLQGD 36 >SB_3376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 65.7 bits (153), Expect = 9e-11 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -2 Query: 1041 AXNLPFAIRLRNCWXGDRCGPFRYYASWRKGDVLQGD 931 A + PF RLRNC GDRCGP RYYASWRKGDVLQGD Sbjct: 2 ASHSPF--RLRNCGKGDRCGPLRYYASWRKGDVLQGD 36 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 64.5 bits (150), Expect = 2e-10 Identities = 31/42 (73%), Positives = 32/42 (76%) Frame = +3 Query: 876 TGRRFTTS*LXKPWRYQLNRLAAHPPFASWRNSEKARTDRXS 1001 TGRRFT P QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 81 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 64.5 bits (150), Expect = 2e-10 Identities = 35/42 (83%), Positives = 35/42 (83%) Frame = -1 Query: 1033 FAIRHQAAQLLEXRSVRAFSLLRQLAKGGCAARRLSW*RQGF 908 FAI QAAQLLE RSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 12 FAI--QAAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -3 Query: 950 GMCCKAIKLVTPGFXQSRRCKTTAS 876 G + + VTPGF QSRRCKTTAS Sbjct: 38 GCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 64.5 bits (150), Expect = 2e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVTPGF 909 +G AIGAGLFAITPAGERGMCCKAIKLVTP F Sbjct: 1846 LGRAIGAGLFAITPAGERGMCCKAIKLVTPVF 1877 Score = 60.5 bits (140), Expect = 3e-09 Identities = 33/67 (49%), Positives = 37/67 (55%) Frame = -1 Query: 1042 RXQFAIRHQAAQLLEXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPVNCNT 863 R FAI QAAQLL + + G + + F SHDVVKRRPVNCNT Sbjct: 1835 RVPFAI--QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPVFPSHDVVKRRPVNCNT 1892 Query: 862 THYRANW 842 THYRANW Sbjct: 1893 THYRANW 1899 >SB_35241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 64.5 bits (150), Expect = 2e-10 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -2 Query: 1017 RLRNCWXGDRCGPFRYYASWRKGDVLQGD 931 RLRNC GDRCGP RYYASWRKGDVLQGD Sbjct: 15 RLRNCGKGDRCGPLRYYASWRKGDVLQGD 43 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 64.1 bits (149), Expect = 3e-10 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXSNSCAA 1016 QLNRLAAHPPFASWRNSE+ARTDR S+SCAA Sbjct: 70 QLNRLAAHPPFASWRNSEEARTDRPSHSCAA 100 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) Length = 1270 Score = 62.9 bits (146), Expect = 6e-10 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVTPGFXQSRRCKTTA 879 +G AIGAGLFAITPAGERGMCCKAIKL TP ++R+ T+ Sbjct: 1132 LGRAIGAGLFAITPAGERGMCCKAIKLDTPSSPRARKFGETS 1173 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 62.9 bits (146), Expect = 6e-10 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 3/62 (4%) Frame = -1 Query: 1018 QAAQLLEXRSVRA--FSLLRQLAKGGCAARRLSW*-RQGFXSHDVVKRRPVNCNTTHYRA 848 QAAQLL R++ A F++ KG L RQGF SHDVVKRRPVNCNTTHYRA Sbjct: 42 QAAQLL-GRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRA 100 Query: 847 NW 842 NW Sbjct: 101 NW 102 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 62.1 bits (144), Expect = 1e-09 Identities = 34/42 (80%), Positives = 34/42 (80%) Frame = -1 Query: 1033 FAIRHQAAQLLEXRSVRAFSLLRQLAKGGCAARRLSW*RQGF 908 FAI QAAQL E RSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 12 FAI--QAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -3 Query: 950 GMCCKAIKLVTPGFXQSRRCKTTAS 876 G + + VTPGF QSRRCKTTAS Sbjct: 38 GCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 62.1 bits (144), Expect = 1e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXSNSCAA 1016 QLNRLAAHPPFASWRNSE+ARTDR S CAA Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPSQQCAA 75 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 62.1 bits (144), Expect = 1e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXSNSCAA 1016 QLNRLAAHPPFASWRNSE+ARTDR S CAA Sbjct: 528 QLNRLAAHPPFASWRNSEEARTDRPSQQCAA 558 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 512 LAVVLQRRDWENPGVTQLNRLAAHP 536 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 62.1 bits (144), Expect = 1e-09 Identities = 34/42 (80%), Positives = 34/42 (80%) Frame = -1 Query: 1033 FAIRHQAAQLLEXRSVRAFSLLRQLAKGGCAARRLSW*RQGF 908 FAI QAAQL E RSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 12 FAI--QAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -3 Query: 950 GMCCKAIKLVTPGFXQSRRCKTTAS 876 G + + VTPGF QSRRCKTTAS Sbjct: 38 GCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 61.7 bits (143), Expect = 1e-09 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVTPGFXQSRRCKTTASEL 870 +G AIGAGLFAITPAGERGMCCKAIKLV F + K T E+ Sbjct: 20 LGRAIGAGLFAITPAGERGMCCKAIKLVITHFIECLCEKYTTGEM 64 >SB_9986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 61.7 bits (143), Expect = 1e-09 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -2 Query: 1041 AXNLPFAIRLRNCWXGDRCGPFRYYASWRKGDVLQGD 931 A + PF RLRNC GDRCG RYYASWRKGDVLQGD Sbjct: 2 ASHSPF--RLRNCGKGDRCGLLRYYASWRKGDVLQGD 36 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 61.3 bits (142), Expect = 2e-09 Identities = 31/42 (73%), Positives = 31/42 (73%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPV 875 E RSVRA SLLRQLAKGGCAARRLSW GF KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 61.3 bits (142), Expect = 2e-09 Identities = 31/42 (73%), Positives = 31/42 (73%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPV 875 E RSVRA SLLRQLAKGGCAARRLSW GF KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 61.3 bits (142), Expect = 2e-09 Identities = 31/42 (73%), Positives = 31/42 (73%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPV 875 E RSVRA SLLRQLAKGGCAARRLSW GF KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 61.3 bits (142), Expect = 2e-09 Identities = 31/42 (73%), Positives = 31/42 (73%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPV 875 E RSVRA SLLRQLAKGGCAARRLSW GF KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 61.3 bits (142), Expect = 2e-09 Identities = 31/42 (73%), Positives = 31/42 (73%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPV 875 E RSVRA SLLRQLAKGGCAARRLSW GF KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 61.3 bits (142), Expect = 2e-09 Identities = 31/42 (73%), Positives = 31/42 (73%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPV 875 E RSVRA SLLRQLAKGGCAARRLSW GF KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 61.3 bits (142), Expect = 2e-09 Identities = 31/42 (73%), Positives = 31/42 (73%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPV 875 E RSVRA SLLRQLAKGGCAARRLSW GF KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 60.9 bits (141), Expect = 3e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVTP 915 +G AIGAGLFAITPAGERGMCCKAIKLV P Sbjct: 41 LGRAIGAGLFAITPAGERGMCCKAIKLVEP 70 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 60.9 bits (141), Expect = 3e-09 Identities = 39/75 (52%), Positives = 45/75 (60%), Gaps = 1/75 (1%) Frame = +2 Query: 821 TRGGARYPIRPIVSRITIHWPSFYNVVTGKTLALPT*SPCST-SPFRQLA**RKGPHRSP 997 T GGA PIRPIVSRITIHWP+FYN TGKTLA + + PF ++ P Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRP 91 Query: 998 FQQLRSLMANGKLXA 1042 QQLRSL NG+ A Sbjct: 92 SQQLRSL--NGEWDA 104 >SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 60.5 bits (140), Expect = 3e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVT 918 +G AIGAGLFAITPAGERGMCCKAIKLVT Sbjct: 86 LGRAIGAGLFAITPAGERGMCCKAIKLVT 114 >SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) Length = 173 Score = 60.5 bits (140), Expect = 3e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVT 918 +G AIGAGLFAITPAGERGMCCKAIKLVT Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKLVT 41 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 60.1 bits (139), Expect = 4e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -1 Query: 919 RQGFXSHDVVKRRPVNCNTTHYRANW 842 R GF SHDVVKRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 60.1 bits (139), Expect = 4e-09 Identities = 30/43 (69%), Positives = 31/43 (72%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVTPGFXQSRRCKTTAS 876 +G AIGAGLFAITPAGERGMCCKAIKL KTTAS Sbjct: 20 LGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTFKTTAS 62 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 60.1 bits (139), Expect = 4e-09 Identities = 37/69 (53%), Positives = 42/69 (60%), Gaps = 2/69 (2%) Frame = -1 Query: 1042 RXQFAIRHQAAQLLEXRSVRA--FSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPVNC 869 R FAI QAAQLL R++ A F++ +G C F SHDVVKRRPVNC Sbjct: 2 RVPFAI--QAAQLL-GRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNC 58 Query: 868 NTTHYRANW 842 NTTHYRANW Sbjct: 59 NTTHYRANW 67 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +3 Query: 876 TGRRFTTS*LXKPWRYQLNRLAAHPPFASWRNSEKARTDRXS 1001 TGRR P QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 56 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 59.7 bits (138), Expect = 6e-09 Identities = 30/36 (83%), Positives = 30/36 (83%) Frame = -1 Query: 1015 AAQLLEXRSVRAFSLLRQLAKGGCAARRLSW*RQGF 908 AAQL E RSVRA SLLRQLAKGGCAARRLSW GF Sbjct: 1 AAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 36 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -3 Query: 950 GMCCKAIKLVTPGFXQSRRCKTTASEL 870 G + + VTPGF QSRRCKTTASEL Sbjct: 23 GCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 59.7 bits (138), Expect = 6e-09 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +3 Query: 876 TGRRFTTS*LXKPWRYQLNRLAAHPPFASWRNSEKARTDRXS 1001 TGRR P QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 76 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 59.7 bits (138), Expect = 6e-09 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +3 Query: 876 TGRRFTTS*LXKPWRYQLNRLAAHPPFASWRNSEKARTDRXS 1001 TGRR P QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 66 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 59.7 bits (138), Expect = 6e-09 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +3 Query: 876 TGRRFTTS*LXKPWRYQLNRLAAHPPFASWRNSEKARTDRXS 1001 TGRR P QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 86 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 59.7 bits (138), Expect = 6e-09 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +3 Query: 876 TGRRFTTS*LXKPWRYQLNRLAAHPPFASWRNSEKARTDRXS 1001 TGRR P QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 113 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 59.7 bits (138), Expect = 6e-09 Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS---NSCAA*WRMANXKRYI 1049 QLNRLAAHPPFASWRNSE+ARTDR S S WR+ KR I Sbjct: 67 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTKRNI 111 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 104 >SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1311 Score = 59.7 bits (138), Expect = 6e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVTPGF 909 +G AIGAGLFAITPAGERGMCCKAIKL PGF Sbjct: 121 LGRAIGAGLFAITPAGERGMCCKAIKL-EPGF 151 >SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) Length = 405 Score = 58.8 bits (136), Expect = 1e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVT 918 +G AIGAGLFAITPAGERGMCCKAIKLV+ Sbjct: 105 LGRAIGAGLFAITPAGERGMCCKAIKLVS 133 >SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 58.8 bits (136), Expect = 1e-08 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = -3 Query: 1028 HSPSGCATV-GXAIGAGLFAITPAGERGMCCKAIKLV 921 HSP + G AIGAGLFAITPAGERGMCCKAIKLV Sbjct: 9 HSPFRLRKLLGRAIGAGLFAITPAGERGMCCKAIKLV 45 >SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) Length = 108 Score = 58.8 bits (136), Expect = 1e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVT 918 +G AIGAGLFAITPAGERGMCCKAIKLV+ Sbjct: 15 LGRAIGAGLFAITPAGERGMCCKAIKLVS 43 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 58.4 bits (135), Expect = 1e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -1 Query: 916 QGFXSHDVVKRRPVNCNTTHYRANW 842 +GF SHDVVKRRPVNCNTTHYRANW Sbjct: 35 KGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 56.0 bits (129), Expect = 7e-08 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 1013 CATVGXAIGAGLFAITPAGERGMCCKAIKL 924 CATVG GLFAITPAGERGMCCKAIKL Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKL 31 >SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) Length = 407 Score = 58.4 bits (135), Expect = 1e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLV 921 +G AIGAGLFAITPAGERGMCCKAIKLV Sbjct: 20 LGRAIGAGLFAITPAGERGMCCKAIKLV 47 >SB_37193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 58.4 bits (135), Expect = 1e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLV 921 +G AIGAGLFAITPAGERGMCCKAIKLV Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKLV 40 >SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) Length = 556 Score = 58.4 bits (135), Expect = 1e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLV 921 +G AIGAGLFAITPAGERGMCCKAIKLV Sbjct: 267 LGRAIGAGLFAITPAGERGMCCKAIKLV 294 >SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 58.4 bits (135), Expect = 1e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLV 921 +G AIGAGLFAITPAGERGMCCKAIKLV Sbjct: 192 LGRAIGAGLFAITPAGERGMCCKAIKLV 219 >SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) Length = 745 Score = 58.4 bits (135), Expect = 1e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLV 921 +G AIGAGLFAITPAGERGMCCKAIKLV Sbjct: 397 LGRAIGAGLFAITPAGERGMCCKAIKLV 424 >SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) Length = 1283 Score = 58.0 bits (134), Expect = 2e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVTP 915 +G AIGAGLFAITPAGERGMCCKAIKL P Sbjct: 20 LGRAIGAGLFAITPAGERGMCCKAIKLDLP 49 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 58.0 bits (134), Expect = 2e-08 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -1 Query: 913 GFXSHDVVKRRPVNCNTTHYRANW 842 GF SHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 58.0 bits (134), Expect = 2e-08 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 2/61 (3%) Frame = -1 Query: 1018 QAAQLLEXRSVRA--FSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPVNCNTTHYRAN 845 QAAQLL R++ A F++ +G C F SHDVVKRRPVNCNTTHYRAN Sbjct: 2 QAAQLL-GRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRAN 60 Query: 844 W 842 W Sbjct: 61 W 61 Score = 55.6 bits (128), Expect = 1e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCK+IKL Sbjct: 7 LGRAIGAGLFAITPAGERGMCCKSIKL 33 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 58.0 bits (134), Expect = 2e-08 Identities = 35/67 (52%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = +2 Query: 845 IRPIVSRITIHWPSFYNVVTGKTLALPT*SPCSTSPFRQLA**RKGPHRS-PFQQLRSLM 1021 +RP+VSRITIHW SFYNVVTGKTLALP P + P QQLRSL Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSL- 91 Query: 1022 ANGKLXA 1042 NG+ A Sbjct: 92 -NGEWDA 97 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 58.0 bits (134), Expect = 2e-08 Identities = 35/65 (53%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = +2 Query: 851 PIVSRITIHWPSFYNVVTGKTLALPT*SPCSTSPFRQLA**RKGPHRS-PFQQLRSLMAN 1027 P +SRITIHWPSFYNVVTGKTLALP P R+ P QQLRSL N Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSL--N 134 Query: 1028 GKLXA 1042 G+ A Sbjct: 135 GEWDA 139 >SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 57.6 bits (133), Expect = 2e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXSN 1004 QLNRLAAHPPFASWRNSE+ARTDR SN Sbjct: 36 QLNRLAAHPPFASWRNSEEARTDRPSN 62 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) Length = 799 Score = 57.6 bits (133), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVT 918 +G AIGAGLFAITPAGERGMCCKAIKL T Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKLGT 41 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 57.6 bits (133), Expect = 2e-08 Identities = 28/36 (77%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +1 Query: 925 NLIALQHIPLSPAGVIAKRPAPIAXP-TVAQPDGEW 1029 NLIALQHIPLSPAGVIAKRPAPIA P + +GEW Sbjct: 24 NLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 Score = 52.0 bits (119), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 860 SRITIHWPSFYNVVTGKTLALP 925 SRITIHWPSFYNVVTGKTLALP Sbjct: 2 SRITIHWPSFYNVVTGKTLALP 23 >SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 57.6 bits (133), Expect = 2e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVTP 915 +G AIGAGLFAITPAGERGMCCKAIKL P Sbjct: 237 LGRAIGAGLFAITPAGERGMCCKAIKLGFP 266 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 57.2 bits (132), Expect = 3e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 1015 AAQLLEXRSVRAFSLLRQLAKGGCAARRLSW 923 AAQL E RSVRA SLLRQLAKGGCAARRLSW Sbjct: 1 AAQLWEGRSVRASSLLRQLAKGGCAARRLSW 31 Score = 38.3 bits (85), Expect = 0.015 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = -3 Query: 950 GMCCKAIKLVTPGFXQSRRCKTTASEL 870 G + + VTP F QSRRCKTTASEL Sbjct: 23 GCAARRLSWVTPVFSQSRRCKTTASEL 49 >SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) Length = 340 Score = 57.2 bits (132), Expect = 3e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVTPG 912 +G AIGAGLFAITPAGERGMCCKAIKL G Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKLGVNG 43 >SB_42228| Best HMM Match : Moricin (HMM E-Value=6.6) Length = 126 Score = 57.2 bits (132), Expect = 3e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVTPG 912 +G AIGAGLFAITPAGERGMCCKAIKL G Sbjct: 20 LGRAIGAGLFAITPAGERGMCCKAIKLEQNG 50 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 1955 LGRAIGAGLFAITPAGERGMCCKAIKL 1981 >SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) Length = 106 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) Length = 584 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) Length = 980 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_41709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 460 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 20 LGRAIGAGLFAITPAGERGMCCKAIKL 46 >SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) Length = 369 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_26951| Best HMM Match : CUB (HMM E-Value=0) Length = 794 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 129 LGRAIGAGLFAITPAGERGMCCKAIKL 155 >SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2806 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 2658 LGRAIGAGLFAITPAGERGMCCKAIKL 2684 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSEKARTDR S Sbjct: 139 QLNRLAAHPPFASWRNSEKARTDRPS 164 Score = 39.1 bits (87), Expect = 0.009 Identities = 23/52 (44%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEW 1029 LAVVLQRRDW NPGVT L L H P + K + +GEW Sbjct: 123 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLNGEW 174 >SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 120 LGRAIGAGLFAITPAGERGMCCKAIKL 146 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSEKARTDR S Sbjct: 74 QLNRLAAHPPFASWRNSEKARTDRPS 99 Score = 39.1 bits (87), Expect = 0.009 Identities = 23/52 (44%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEW 1029 LAVVLQRRDW NPGVT L L H P + K + +GEW Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLNGEW 109 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 3094 LGRAIGAGLFAITPAGERGMCCKAIKL 3120 >SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) Length = 1169 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 741 LGRAIGAGLFAITPAGERGMCCKAIKL 767 >SB_39908| Best HMM Match : Prismane (HMM E-Value=3) Length = 456 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 Score = 53.6 bits (123), Expect = 4e-07 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -1 Query: 1000 EXRSVRAFSLLRQLAKGGCAARRLSW*RQGFXSH 899 E RSVRA SLLRQLAKGGCAARRLSW R+ H Sbjct: 331 EGRSVRASSLLRQLAKGGCAARRLSWGRESGTVH 364 >SB_37382| Best HMM Match : Pkinase (HMM E-Value=1e-04) Length = 177 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) Length = 472 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G AIGAGLFAITPAGERGMCCKAIKL Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 4e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSEKARTDR S Sbjct: 24 QLNRLAAHPPFASWRNSEKARTDRPS 49 Score = 42.7 bits (96), Expect = 7e-04 Identities = 28/62 (45%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +2 Query: 860 SRITIHWPSFYNVVTGKTLALPT*SPCST-SPFRQLA**RKGPHRSPFQQLRSLMANGKL 1036 SRITIHWPSFYNV+ KT + + + PF K P QQLRSL NG+ Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSL--NGEW 59 Query: 1037 XA 1042 A Sbjct: 60 DA 61 >SB_5886| Best HMM Match : DUF1205 (HMM E-Value=5.9) Length = 85 Score = 56.8 bits (131), Expect = 4e-08 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +1 Query: 925 NLIALQHIPLSPAGVIAKRPAPIAXPTVAQP-DGEW 1029 NLIALQH+PLSPAGVI KRPAPIA P + + +GEW Sbjct: 10 NLIALQHVPLSPAGVIPKRPAPIALPNMLRSLNGEW 45 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 56.4 bits (130), Expect = 5e-08 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 3/43 (6%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS---NSCAA*WRMANXKR 1043 QLNRLAAHPPFASWRNSE+ARTDR S S WR+ +R Sbjct: 214 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRPQR 256 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 198 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 251 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 56.0 bits (129), Expect = 7e-08 Identities = 28/43 (65%), Positives = 30/43 (69%), Gaps = 3/43 (6%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS---NSCAA*WRMANXKR 1043 QLNRLAAHPPFASWRNSE+ARTDR S S WR+ R Sbjct: 207 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYMR 249 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 244 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 55.6 bits (128), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRN+EKARTDR S Sbjct: 65 QLNRLAAHPPFASWRNNEKARTDRPS 90 Score = 38.7 bits (86), Expect = 0.012 Identities = 23/52 (44%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEW 1029 LAVVLQRRDW NPGVT L L H P + K + +GEW Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNNEKARTDRPSQQLRSLNGEW 100 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 55.6 bits (128), Expect = 1e-07 Identities = 34/62 (54%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Frame = +2 Query: 860 SRITIHWPSFYNVVTGKTLALPT-*SPCSTSPFRQLA**RKGPHRSPFQQLRSLMANGKL 1036 SRITIHWPSFYNVVTGKTLALP + + PF + P QQLRSL NG+ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSL--NGEW 59 Query: 1037 XA 1042 A Sbjct: 60 DA 61 >SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 55.6 bits (128), Expect = 1e-07 Identities = 26/43 (60%), Positives = 29/43 (67%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKLVTPGFXQSRRCKTTAS 876 +G AIGAGLF ITPA ERGMC + + V P F QS RC AS Sbjct: 15 LGRAIGAGLFDITPACERGMCARRLSWVMPAFSQSSRCIMAAS 57 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 55.6 bits (128), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRN+EKARTDR S Sbjct: 63 QLNRLAAHPPFASWRNNEKARTDRPS 88 Score = 38.7 bits (86), Expect = 0.012 Identities = 23/52 (44%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEW 1029 LAVVLQRRDW NPGVT L L H P + K + +GEW Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNNEKARTDRPSQQLRSLNGEW 98 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 55.6 bits (128), Expect = 1e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 1004 VGXAIGAGLFAITPAGERGMCCKAIKL 924 +G +IGAGLFAITPAGERGMCCKAIKL Sbjct: 44 LGRSIGAGLFAITPAGERGMCCKAIKL 70 Score = 53.6 bits (123), Expect = 4e-07 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Frame = -1 Query: 1024 RHQAAQLLEXRSVRA--FSLLRQLAKGGCAARRLSW*RQGFXSHDVVKRRPVNCNTTHYR 851 R++ AQLL RS+ A F++ +G C +GF SHD KRRPVNCNTTHYR Sbjct: 37 RYRVAQLL-GRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYR 95 Query: 850 AN 845 AN Sbjct: 96 AN 97 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 55.6 bits (128), Expect = 1e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 910 FXSHDVVKRRPVNCNTTHYRANW 842 F SHDVVKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 55.6 bits (128), Expect = 1e-07 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS---NSCAA*WRMANXK 1040 QLNRLAAHPPFASWRNSE+ARTDR S S WR+ + Sbjct: 545 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRAR 586 Score = 40.7 bits (91), Expect = 0.003 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +1 Query: 820 NSRGGPVXXXXXXXXXXXXLAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIA 996 N RG P+ LAVVLQRRDW NPGVT L L H P + + Sbjct: 512 NQRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 569 Query: 997 XPTVAQPDGEWQI 1035 + +GEW++ Sbjct: 570 SQQLRSLNGEWRL 582 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 55.6 bits (128), Expect = 1e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 910 FXSHDVVKRRPVNCNTTHYRANW 842 F SHDVVKRRPVNCNTTHYRANW Sbjct: 31 FPSHDVVKRRPVNCNTTHYRANW 53 Score = 54.4 bits (125), Expect = 2e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 995 AIGAGLFAITPAGERGMCCKAIKL 924 AIGAGLFAITPAGERGMCCKAIKL Sbjct: 2 AIGAGLFAITPAGERGMCCKAIKL 25 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 51 QLNRLAAHPPFASWRNSEEARTDRPS 76 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHP 59 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 78 QLNRLAAHPPFASWRNSEEARTDRPS 103 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 60 QLNRLAAHPPFASWRNSEEARTDRPS 85 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 52 QLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 78 QLNRLAAHPPFASWRNSEEARTDRPS 103 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 58 QLNRLAAHPPFASWRNSEEARTDRPS 83 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW N GVT L L P Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHP 66 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 83 QLNRLAAHPPFASWRNSEEARTDRPS 108 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 54 QLNRLAAHPPFASWRNSEEARTDRPS 79 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 74 QLNRLAAHPPFASWRNSEEARTDRPS 99 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 86 QLNRLAAHPPFASWRNSEEARTDRPS 111 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 62 QLNRLAAHPPFASWRNSEEARTDRPS 87 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHP 70 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 51 QLNRLAAHPPFASWRNSEEARTDRPS 76 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHP 59 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 41 QLNRLAAHPPFASWRNSEEARTDRPS 66 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 66 QLNRLAAHPPFASWRNSEEARTDRPS 91 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 75 QLNRLAAHPPFASWRNSEEARTDRPS 100 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 69 QLNRLAAHPPFASWRNSEEARTDRPS 94 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHP 77 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 85 QLNRLAAHPPFASWRNSEEARTDRPS 110 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 73 QLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 56 QLNRLAAHPPFASWRNSEEARTDRPS 81 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW N GVT L L P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 232 QLNRLAAHPPFASWRNSEEARTDRPS 257 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHP 240 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 127 QLNRLAAHPPFASWRNSEEARTDRPS 152 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHP 135 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 65 QLNRLAAHPPFASWRNSEEARTDRPS 90 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 44 QLNRLAAHPPFASWRNSEEARTDRPS 69 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 32 QLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 63 QLNRLAAHPPFASWRNSEEARTDRPS 88 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHP 71 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 397 QLNRLAAHPPFASWRNSEEARTDRPS 422 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHP 405 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 123 QLNRLAAHPPFASWRNSEEARTDRPS 148 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHP 131 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 99 QLNRLAAHPPFASWRNSEEARTDRPS 124 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 55 QLNRLAAHPPFASWRNSEEARTDRPS 80 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 24 QLNRLAAHPPFASWRNSEEARTDRPS 49 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHP 32 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 34 QLNRLAAHPPFASWRNSEEARTDRPS 59 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 54 QLNRLAAHPPFASWRNSEEARTDRPS 79 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 119 QLNRLAAHPPFASWRNSEEARTDRPS 144 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHP 127 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 61 QLNRLAAHPPFASWRNSEEARTDRPS 86 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHP 69 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 356 QLNRLAAHPPFASWRNSEEARTDRPS 381 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHP 364 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 96 QLNRLAAHPPFASWRNSEEARTDRPS 121 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHP 104 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 66 QLNRLAAHPPFASWRNSEEARTDRPS 91 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 32 QLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 75 QLNRLAAHPPFASWRNSEEARTDRPS 100 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 59 QLNRLAAHPPFASWRNSEEARTDRPS 84 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 150 QLNRLAAHPPFASWRNSEEARTDRPS 175 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHP 158 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 79 QLNRLAAHPPFASWRNSEEARTDRPS 104 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 55 QLNRLAAHPPFASWRNSEEARTDRPS 80 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 159 QLNRLAAHPPFASWRNSEEARTDRPS 184 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHP 167 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 849 QLNRLAAHPPFASWRNSEEARTDRPS 874 Score = 39.9 bits (89), Expect = 0.005 Identities = 26/72 (36%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +1 Query: 823 SRGGPVXXXXXXXXXXXXLAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAX 999 SRG P+ LAVVLQRRDW NPGVT L L H P + + Sbjct: 817 SRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 874 Query: 1000 PTVAQPDGEWQI 1035 + +GEW++ Sbjct: 875 QQLRSLNGEWRL 886 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 32 QLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 76 QLNRLAAHPPFASWRNSEEARTDRPS 101 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 50 QLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 89 QLNRLAAHPPFASWRNSEEARTDRPS 114 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 51 QLNRLAAHPPFASWRNSEEARTDRPS 76 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW N GVT L L P Sbjct: 35 LAVVLQRRDWENTGVTQLNRLAAHP 59 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 72 QLNRLAAHPPFASWRNSEEARTDRPS 97 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 85 QLNRLAAHPPFASWRNSEEARTDRPS 110 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 81 QLNRLAAHPPFASWRNSEEARTDRPS 106 Score = 35.1 bits (77), Expect = 0.14 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQR DW NPGVT L L P Sbjct: 65 LAVVLQRLDWENPGVTQLNRLAAHP 89 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 272 QLNRLAAHPPFASWRNSEEARTDRPS 297 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHP 280 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW N GVT L L P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 130 QLNRLAAHPPFASWRNSEEARTDRPS 155 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 66 QLNRLAAHPPFASWRNSEEARTDRPS 91 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 52 QLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 53 QLNRLAAHPPFASWRNSEEARTDRPS 78 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 117 QLNRLAAHPPFASWRNSEEARTDRPS 142 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHP 125 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 130 QLNRLAAHPPFASWRNSEEARTDRPS 155 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHP 138 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 55 QLNRLAAHPPFASWRNSEEARTDRPS 80 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 36 QLNRLAAHPPFASWRNSEEARTDRPS 61 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 74 QLNRLAAHPPFASWRNSEEARTDRPS 99 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 53 QLNRLAAHPPFASWRNSEEARTDRPS 78 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 50 QLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 27 QLNRLAAHPPFASWRNSEEARTDRPS 52 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 35 QLNRLAAHPPFASWRNSEEARTDRPS 60 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 412 QLNRLAAHPPFASWRNSEEARTDRPS 437 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHP 420 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 61 QLNRLAAHPPFASWRNSEEARTDRPS 86 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHP 69 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 70 QLNRLAAHPPFASWRNSEEARTDRPS 95 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 52 QLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 135 QLNRLAAHPPFASWRNSEEARTDRPS 160 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHP 143 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 71 QLNRLAAHPPFASWRNSEEARTDRPS 96 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 81 QLNRLAAHPPFASWRNSEEARTDRPS 106 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 84 QLNRLAAHPPFASWRNSEEARTDRPS 109 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHP 92 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 430 QLNRLAAHPPFASWRNSEEARTDRPS 455 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHP 438 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 127 QLNRLAAHPPFASWRNSEEARTDRPS 152 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHP 135 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 83 QLNRLAAHPPFASWRNSEEARTDRPS 108 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 72 QLNRLAAHPPFASWRNSEEARTDRPS 97 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 62 QLNRLAAHPPFASWRNSEEARTDRPS 87 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHP 70 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW N GVT L L P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 177 QLNRLAAHPPFASWRNSEEARTDRPS 202 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHP 185 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 81 QLNRLAAHPPFASWRNSEEARTDRPS 106 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 68 QLNRLAAHPPFASWRNSEEARTDRPS 93 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHP 76 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 104 QLNRLAAHPPFASWRNSEEARTDRPS 129 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 70 QLNRLAAHPPFASWRNSEEARTDRPS 95 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW N GVT L L P Sbjct: 54 LAVVLQRRDWENTGVTQLNRLAAHP 78 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 53 QLNRLAAHPPFASWRNSEEARTDRPS 78 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 79 QLNRLAAHPPFASWRNSEEARTDRPS 104 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 22 QLNRLAAHPPFASWRNSEEARTDRPS 47 Score = 41.5 bits (93), Expect = 0.002 Identities = 24/55 (43%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +2 Query: 875 HWPSFYNVVTGKTLALPT*SPCST-SPFRQLA**RKGPHRSPFQQLRSLMANGKL 1036 HWPSFYNVVTGKTL + + + PF + P QQLRSL +L Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 59 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 58 QLNRLAAHPPFASWRNSEEARTDRPS 83 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHP 66 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 201 QLNRLAAHPPFASWRNSEEARTDRPS 226 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHP 209 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 50 QLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 56 QLNRLAAHPPFASWRNSEEARTDRPS 81 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 70 QLNRLAAHPPFASWRNSEEARTDRPS 95 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 67 QLNRLAAHPPFASWRNSEEARTDRPS 92 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHP 75 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 50 QLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 51 QLNRLAAHPPFASWRNSEEARTDRPS 76 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHP 59 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 65 QLNRLAAHPPFASWRNSEEARTDRPS 90 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 55 QLNRLAAHPPFASWRNSEEARTDRPS 80 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 148 QLNRLAAHPPFASWRNSEEARTDRPS 173 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 57 QLNRLAAHPPFASWRNSEEARTDRPS 82 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 100 QLNRLAAHPPFASWRNSEEARTDRPS 125 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 38 QLNRLAAHPPFASWRNSEEARTDRPS 63 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 169 QLNRLAAHPPFASWRNSEEARTDRPS 194 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 356 QLNRLAAHPPFASWRNSEEARTDRPS 381 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHP 364 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW N GVT L L P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 106 QLNRLAAHPPFASWRNSEEARTDRPS 131 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW N GVT L L P Sbjct: 90 LAVVLQRRDWENTGVTQLNRLAAHP 114 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 73 QLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 37 QLNRLAAHPPFASWRNSEEARTDRPS 62 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 63 QLNRLAAHPPFASWRNSEEARTDRPS 88 Score = 36.3 bits (80), Expect = 0.062 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 L VVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 125 QLNRLAAHPPFASWRNSEEARTDRPS 150 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHP 133 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 29.5 bits (63), Expect = 7.2 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRD N GVT L L P Sbjct: 29 LAVVLQRRDGENTGVTQLNRLAAHP 53 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 102 QLNRLAAHPPFASWRNSEEARTDRPS 127 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHP 110 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 52 QLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 76 QLNRLAAHPPFASWRNSEEARTDRPS 101 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 310 QLNRLAAHPPFASWRNSEEARTDRPS 335 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHP 318 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 73 QLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 74 QLNRLAAHPPFASWRNSEEARTDRPS 99 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 32 QLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIAL-QHIPLSPAGVIAKRPAPIAXPTVAQPDGEWQI 1035 LAVVLQRRDW NPGVT L L H P + + + +GEW++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 52 QLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 427 QLNRLAAHPPFASWRNSEEARTDRPS 452 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHP 435 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 111 QLNRLAAHPPFASWRNSEEARTDRPS 136 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHP 119 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 67 QLNRLAAHPPFASWRNSEEARTDRPS 92 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHP 75 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 59 QLNRLAAHPPFASWRNSEEARTDRPS 84 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 45 QLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW N GVT L L P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 58 QLNRLAAHPPFASWRNSEEARTDRPS 83 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW N GVT L L P Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHP 66 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 109 QLNRLAAHPPFASWRNSEEARTDRPS 134 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 924 QLNRLAAHPPFASWRNSEKARTDRXS 1001 QLNRLAAHPPFASWRNSE+ARTDR S Sbjct: 59 QLNRLAAHPPFASWRNSEEARTDRPS 84 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 877 LAVVLQRRDWXNPGVTNLIALQHIP 951 LAVVLQRRDW NPGVT L L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,854,700 Number of Sequences: 59808 Number of extensions: 740959 Number of successful extensions: 9062 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8990 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4777275239 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -