BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_D12_e572_08.seq (1514 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 25 1.5 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 2.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 2.6 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 25.0 bits (52), Expect = 1.5 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +1 Query: 730 VKL*RPFRSTALARLKK--KVPALCLWQAISCYI 825 +K P + L RL K K P LC+ +SCY+ Sbjct: 203 IKTSGPHKFQPLLRLPKFKKKPLLCVVSTLSCYL 236 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.2 bits (50), Expect = 2.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 401 NVSGNRLATLFVEPMPDGAHGFSNS 327 N GN+LA L+ PD + F N+ Sbjct: 352 NEQGNKLADLYKSLGPDSVYSFINN 376 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.2 bits (50), Expect = 2.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 401 NVSGNRLATLFVEPMPDGAHGFSNS 327 N GN+LA L+ PD + F N+ Sbjct: 244 NEQGNKLADLYKSLGPDSVYSFINN 268 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 299,589 Number of Sequences: 336 Number of extensions: 6555 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45476700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -