BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_D12_e572_08.seq (1514 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) 31 1.8 SB_14305| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 >SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) Length = 591 Score = 31.5 bits (68), Expect = 1.8 Identities = 20/68 (29%), Positives = 35/68 (51%) Frame = +3 Query: 120 IVHIIEQIMHITNPSIH*TTSTAGHRSPPKISTTTGLAPPVSSELPRPSPGRRSTLWGAY 299 I+ II ++ ++P TT+T + P +S +T +PP S + P P P R+T + Sbjct: 35 IISIIVVVVINSSPPPPPTTTT----TTPSLSLSTSTSPPFSYKSPDPWPNTRNTDITLH 90 Query: 300 PRCVFQYT 323 +C +T Sbjct: 91 QKCETLFT 98 >SB_14305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 29.5 bits (63), Expect = 7.4 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +2 Query: 224 RSCATRIQRTPATFTRSSVHLVGSLPTLRLPVHGNY*RTHGPHRASVLRITWLAYYHLHL 403 R+ T R A FT ++ LVGSLP L + + T P A V + L Y ++ Sbjct: 134 RNALTLKGRFQAWFTTRNILLVGSLPYLGIVIISELLVTFAPSHAIVSFVCQLIYTVINF 193 Query: 404 AI 409 A+ Sbjct: 194 AL 195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,687,427 Number of Sequences: 59808 Number of extensions: 811074 Number of successful extensions: 2451 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2446 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4918128563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -