BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_D11_e564_07.seq (1540 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16300.2 68418.m01906 expressed protein 32 0.88 At5g16300.1 68418.m01905 expressed protein 32 0.88 >At5g16300.2 68418.m01906 expressed protein Length = 1034 Score = 32.3 bits (70), Expect = 0.88 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +1 Query: 118 LSTKASEVENDXNSDKILNTGS-DGYFSTRQLYKDTDPGPYVVSVELVSEDPKAGTTXHP 294 ++ A D K++N G DG T QL + DP ++ + E+ K H Sbjct: 862 INRSAYRRRQDQQKTKLVNRGRIDGV--TSQLTQKLDPIDWLTYEPYLWENEKQSYLRHA 919 Query: 295 LKFGYFLQKNNM 330 + FG+F+Q N M Sbjct: 920 VLFGFFVQLNRM 931 >At5g16300.1 68418.m01905 expressed protein Length = 1068 Score = 32.3 bits (70), Expect = 0.88 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +1 Query: 118 LSTKASEVENDXNSDKILNTGS-DGYFSTRQLYKDTDPGPYVVSVELVSEDPKAGTTXHP 294 ++ A D K++N G DG T QL + DP ++ + E+ K H Sbjct: 862 INRSAYRRRQDQQKTKLVNRGRIDGV--TSQLTQKLDPIDWLTYEPYLWENEKQSYLRHA 919 Query: 295 LKFGYFLQKNNM 330 + FG+F+Q N M Sbjct: 920 VLFGFFVQLNRM 931 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,680,926 Number of Sequences: 28952 Number of extensions: 426082 Number of successful extensions: 847 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 847 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4125317376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -