Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030725E6_D05_e516_07.seq
         (1548 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     24   3.5  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    23   6.1  

>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 23.8 bits (49), Expect = 3.5
 Identities = 22/72 (30%), Positives = 33/72 (45%)
 Frame = -2

Query: 404 PALGVLHVLDADVDAFR*DPAADALVHDHAESVCGHIVNTPCLTVVYFVWHTLLYSAIAP 225
           P L   H +DA +  F  + +     +++ E  C H+VN P  TVV  V   L+    A 
Sbjct: 476 PLLSQRHQIDAKM--FCNESSVSNCENEYCE--CTHVVNIPLGTVVEMV---LIDKGYAY 528

Query: 224 NVNDVSHFVHFH 189
           + N   H +H H
Sbjct: 529 DANHPFH-LHGH 539


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 23.0 bits (47), Expect = 6.1
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 255 PHKVYHGKTGR 287
           PH  Y GKTGR
Sbjct: 302 PHPTYFGKTGR 312


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 268,547
Number of Sequences: 336
Number of extensions: 5318
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 60
effective length of database: 102,425
effective search space used: 46603375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)