BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_D05_e516_07.seq (1548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 26 2.5 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 7.8 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 26.2 bits (55), Expect = 2.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 402 RQDFLKRVKENERLLKEAKAAGKVVNLKRQPAPP 503 R++ +R +E +L EA A + N + QP PP Sbjct: 1101 REEDERRTEERRQLHNEANRAYRQRNRRSQPTPP 1134 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 7.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 736 PCSTFPLSPAGVIAKRPAPIAL 801 P + P SPAGV+ + P+A+ Sbjct: 1335 PANAAPSSPAGVLVAKVPPVAV 1356 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,230,832 Number of Sequences: 2352 Number of extensions: 22851 Number of successful extensions: 46 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 182064960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -