BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_C12_e571_06.seq (1525 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 24 3.0 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 24 3.0 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 24.2 bits (50), Expect = 3.0 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 148 SISSPNPPGSLSFPLHDSPLPTGVAAAPRHPYLYVNNH 261 S S PN PGS + H + L T + + Y NH Sbjct: 64 SPSGPNSPGSFTAGCHSNLLSTSPSGQNKAVAPYPPNH 101 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 24.2 bits (50), Expect = 3.0 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 148 SISSPNPPGSLSFPLHDSPLPTGVAAAPRHPYLYVNNH 261 S S PN PGS + H + L T + + Y NH Sbjct: 64 SPSGPNSPGSFTAGCHSNLLSTSPSGQNKAVAPYPPNH 101 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 250,425 Number of Sequences: 438 Number of extensions: 4106 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 53352750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -