BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_C09_e547_05.seq (1540 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56841| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_20104| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.3 >SB_56841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 340 Score = 58.4 bits (135), Expect = 1e-08 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +3 Query: 84 NDYFTNNILTKEYSMKCKPDDENPLEFEGPEIYSCKG 194 N +FTN +LTK Y MKC+PD+++P FEGPEI S G Sbjct: 304 NPFFTNTVLTKSYKMKCEPDEDDPFSFEGPEIVSTSG 340 >SB_20104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 30.3 bits (65), Expect = 4.3 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 280 VPSPSLCRRIPSSTSSAPPPCRRIL 354 VPSPSL SS SS+PP C R++ Sbjct: 40 VPSPSLPSPPSSSPSSSPPRCLRVI 64 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,173,724 Number of Sequences: 59808 Number of extensions: 488110 Number of successful extensions: 1094 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1093 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5012030779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -