BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_C07_e531_05.seq (1508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 2e-19 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 1e-17 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 2e-17 SB_57861| Best HMM Match : Ribosomal_S30 (HMM E-Value=2e-32) 79 9e-15 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 9e-15 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 1e-14 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 2e-14 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 4e-14 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 77 5e-14 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 6e-14 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 2e-13 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 71 2e-12 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 71 2e-12 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 71 2e-12 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 4e-12 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 6e-12 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 68 2e-11 SB_28080| Best HMM Match : Glycolytic (HMM E-Value=0) 67 3e-11 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_28437| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_14096| Best HMM Match : DUF595 (HMM E-Value=2.1) 63 6e-10 SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_25110| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_17822| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_10411| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) 62 1e-09 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_17772| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_16329| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 62 1e-09 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 62 1e-09 SB_2380| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 62 1e-09 SB_17408| Best HMM Match : I-set (HMM E-Value=7.4e-06) 62 1e-09 SB_55190| Best HMM Match : UCR_TM (HMM E-Value=8.9) 61 2e-09 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 61 2e-09 SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_25859| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) 61 2e-09 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_15159| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 61 3e-09 SB_40748| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) 61 3e-09 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) 61 3e-09 SB_39908| Best HMM Match : Prismane (HMM E-Value=3) 61 3e-09 SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_17057| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 60 3e-09 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) 60 3e-09 SB_30030| Best HMM Match : GATA-N (HMM E-Value=3.8) 60 3e-09 SB_9678| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_27699| Best HMM Match : Sulfotransfer_1 (HMM E-Value=0.51) 60 3e-09 SB_24420| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 60 3e-09 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 60 5e-09 SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) 60 5e-09 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 60 5e-09 SB_31314| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_40757| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 60 5e-09 SB_25902| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_23802| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_19333| Best HMM Match : RNase_P_Rpp14 (HMM E-Value=0.042) 60 5e-09 SB_6227| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_3997| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) 60 6e-09 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58562| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 60 6e-09 SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 60 6e-09 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 60 6e-09 SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 60 6e-09 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 60 6e-09 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 60 6e-09 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 60 6e-09 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 60 6e-09 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 60 6e-09 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 60 6e-09 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 60 6e-09 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 60 6e-09 SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 60 6e-09 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 60 6e-09 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 60 6e-09 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 60 6e-09 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 60 6e-09 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 60 6e-09 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 60 6e-09 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 60 6e-09 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 60 6e-09 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 60 6e-09 SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) 60 6e-09 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_50012| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49975| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49761| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49678| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49547| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49509| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49332| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 60 6e-09 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 60 6e-09 SB_48922| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48921| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48874| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48840| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48531| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48210| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 60 6e-09 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 60 6e-09 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47936| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47873| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47650| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 60 6e-09 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_47060| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46943| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46899| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 60 6e-09 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46559| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 60 6e-09 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 60 6e-09 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 60 6e-09 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46255| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46237| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_46079| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45828| Best HMM Match : S-antigen (HMM E-Value=0.0095) 60 6e-09 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45770| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45428| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45376| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45360| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45128| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44882| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 60 6e-09 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 60 6e-09 SB_44716| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44551| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44440| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 60 6e-09 SB_44121| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 60 6e-09 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_43812| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 60 6e-09 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 60 6e-09 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_43415| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 60 6e-09 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 60 6e-09 SB_43116| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 60 6e-09 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 60 6e-09 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42166| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42148| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 60 6e-09 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41652| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41597| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41534| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41390| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40755| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40671| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40647| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40555| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40354| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39915| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39901| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39749| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39688| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39619| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39535| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39117| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 60 6e-09 SB_39027| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_38970| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 60 6e-09 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 60 6e-09 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 60 6e-09 SB_38657| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_38472| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 94.3 bits (224), Expect = 2e-19 Identities = 43/49 (87%), Positives = 43/49 (87%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGKTLALPNLIALQH PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 11 FYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 88.2 bits (209), Expect = 1e-17 Identities = 41/49 (83%), Positives = 42/49 (85%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGKTLALPNLIALQ PPFASWR SE ARTDRPSQ+LR LNGEW Sbjct: 11 FYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 87.8 bits (208), Expect = 2e-17 Identities = 41/49 (83%), Positives = 41/49 (83%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGKTLALPNLIAL PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 11 FYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 642 LQFHWPSFYNRRDWENPGVTQLNRLAAHXPF 734 + HWPSFYN + + L LAAH PF Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIALAAHPPF 34 >SB_57861| Best HMM Match : Ribosomal_S30 (HMM E-Value=2e-32) Length = 61 Score = 79.0 bits (186), Expect = 9e-15 Identities = 38/59 (64%), Positives = 40/59 (67%) Frame = +1 Query: 316 KVHGSLARAGKVKGQTPXXXXXXXXXXXXXXXXXXIQYNRRFVNVVQTFGRRRGPNSNS 492 KVHGSLARAGKVK QTP +QYNRRFVNVVQTFGRRRGPNSN+ Sbjct: 2 KVHGSLARAGKVKSQTPKVDAQEKKKKKTGRAKRRMQYNRRFVNVVQTFGRRRGPNSNA 60 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 79.0 bits (186), Expect = 9e-15 Identities = 34/41 (82%), Positives = 34/41 (82%) Frame = -2 Query: 793 CATVGKGDRCGPXRXYASWRKGXCAARRLSWVTPGFSQSRR 671 CATVGKGDRCGP R YASWRKG RLSWVTPGFSQSRR Sbjct: 2 CATVGKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRR 42 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 78.6 bits (185), Expect = 1e-14 Identities = 38/49 (77%), Positives = 39/49 (79%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGKTLALPNLIALQH P + R SE ARTDRPSQQLR LNGEW Sbjct: 9 FYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEW 57 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 77.8 bits (183), Expect = 2e-14 Identities = 34/42 (80%), Positives = 34/42 (80%) Frame = -2 Query: 796 GCATVGKGDRCGPXRXYASWRKGXCAARRLSWVTPGFSQSRR 671 GCATVGKGDRCGP R YASWRKG A RLS TPGFSQSRR Sbjct: 30 GCATVGKGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRR 71 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 77.0 bits (181), Expect = 4e-14 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -2 Query: 778 KGDRCGPXRXYASWRKGXCAARRLSWVTPGFSQSRR 671 +GDRCGP R YASWRKG CAARRLSWVTPGFSQSRR Sbjct: 67 QGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRR 102 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 76.6 bits (180), Expect = 5e-14 Identities = 35/46 (76%), Positives = 35/46 (76%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPFRQLAX*RXGPHRSPFPTVAXPEWRM 809 RRDWENPGVTQLNRLAAH PF PHRSPFPTVA PEWRM Sbjct: 350 RRDWENPGVTQLNRLAAHPPFASWRN-SERPHRSPFPTVAQPEWRM 394 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 76.2 bits (179), Expect = 6e-14 Identities = 36/49 (73%), Positives = 38/49 (77%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGKTLALPNL L+H P +AS SE ARTDRPSQQLR LNGEW Sbjct: 11 FYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 75.4 bits (177), Expect = 1e-13 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGKTLALPNLIALQH P + SE ARTDRPSQQLR LNGEW Sbjct: 11 FYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 74.9 bits (176), Expect = 1e-13 Identities = 35/49 (71%), Positives = 37/49 (75%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGKTL++ L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 11 FYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 Score = 44.0 bits (99), Expect = 3e-04 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 642 LQFHWPSFYNRRDWENPGVTQLNRLAAHXPF 734 + HWPSFYN + VTQLNRLAAH PF Sbjct: 4 ITIHWPSFYNVVTGKTLSVTQLNRLAAHPPF 34 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.5 bits (175), Expect = 2e-13 Identities = 35/49 (71%), Positives = 36/49 (73%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGKTL + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 9 FYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 57 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 648 FHWPSFYNRRDWENPGVTQLNRLAAHXPF 734 +HWPSFYN + GVTQLNRLAAH PF Sbjct: 4 WHWPSFYNVVTGKTLGVTQLNRLAAHPPF 32 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 74.1 bits (174), Expect = 3e-13 Identities = 36/49 (73%), Positives = 38/49 (77%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGKTLALPNLIALQH P + +E ARTDRPSQQLR LNGEW Sbjct: 47 FYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLNGEW 95 >SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 74.1 bits (174), Expect = 3e-13 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKL 702 HSPFR RNCWEGRSVRA SL RQLAKGG CCKAIKL Sbjct: 372 HSPFRLRNCWEGRSVRASSLLRQLAKGGCCCKAIKL 407 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 73.7 bits (173), Expect = 3e-13 Identities = 36/49 (73%), Positives = 37/49 (75%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGKTLALPNLIALQH P + E ARTDRPSQQLR LNGEW Sbjct: 89 FYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGEW 137 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 73.3 bits (172), Expect = 5e-13 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -2 Query: 784 VGKGDRCGPXRXYASWRKGXCAARRLSWVTPGFSQSRR 671 +GKGDRCGP R YASWRKG RRLSWVTPGFSQSRR Sbjct: 5 LGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRR 42 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/49 (38%), Positives = 23/49 (46%) Frame = -3 Query: 792 AQLLGRAIGAGLFAXTPAGERGXVLQGD*VG*RQGFPSHDGCKTTASEI 646 AQLLG+ G + +G VLQ GF CKTTASE+ Sbjct: 2 AQLLGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 70.9 bits (166), Expect = 2e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLGNARVFPVTTVVKRRPV 651 HSPFR RNCWEGRSVRA SL RQLAKGG + + G FP VVKRRPV Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG----FPSHDVVKRRPV 67 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 70.9 bits (166), Expect = 2e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLGNARVFPVTTVVKRRPV 651 HSPFR RNCWEGRSVRA SL RQLAKGG + + G FP VVKRRPV Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG----FPSHDVVKRRPV 637 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = -2 Query: 733 KGXCAARRLSWVTPGFSQSRRL*NDGQ*NCNTTHYRAXW 617 KG CAARRLSW P +R NCNTTHYRA W Sbjct: 614 KGGCAARRLSWGFPSHDVVKRR----PVNCNTTHYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 70.9 bits (166), Expect = 2e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLGNARVFPVTTVVKRRPV 651 HSPFR RNCWEGRSVRA SL RQLAKGG + + G FP VVKRRPV Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG----FPSHDVVKRRPV 80 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = -2 Query: 733 KGXCAARRLSWVTPGFSQSRRL*NDGQ*NCNTTHYRAXW 617 KG CAARRLSW P +R NCNTTHYRA W Sbjct: 57 KGGCAARRLSWGFPSHDVVKRR----PVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 70.9 bits (166), Expect = 2e-12 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLGNARVFPVTTVVKRRPV 651 HSPFR RNCWEGRSVRA SL RQLAKGG + + G FP VVKRRPV Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG----FPSHDVVKRRPV 80 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = -2 Query: 733 KGXCAARRLSWVTPGFSQSRRL*NDGQ*NCNTTHYRAXW 617 KG CAARRLSW P +R NCNTTHYRA W Sbjct: 57 KGGCAARRLSWGFPSHDVVKRR----PVNCNTTHYRANW 91 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 70.5 bits (165), Expect = 3e-12 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQ 786 F VTGKTLALPNLIALQH P FASWR S+ ARTDRPSQQ Sbjct: 9 FYNDVTGKTLALPNLIALQHIPTFASWRNSQEARTDRPSQQ 49 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 70.5 bits (165), Expect = 3e-12 Identities = 36/46 (78%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -3 Query: 798 QXAQLLGRAIGAGLFAXTPAGERGXVLQGD-*VG*RQGFPSHDGCK 664 Q AQLLGRAIGAGLFA TPAGE+G VLQGD +G RQGFPSHD K Sbjct: 42 QAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVK 87 Score = 30.3 bits (65), Expect = 4.2 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 649 NCNTTHYRAXW 617 NCNTTHYRA W Sbjct: 92 NCNTTHYRANW 102 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 70.5 bits (165), Expect = 3e-12 Identities = 33/49 (67%), Positives = 34/49 (69%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGK + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 11 FYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 Score = 49.6 bits (113), Expect = 6e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +3 Query: 642 LQFHWPSFYNRRDWENPGVTQLNRLAAHXPF 734 + HWPSFYN +N GVTQLNRLAAH PF Sbjct: 4 ITIHWPSFYNVVTGKNTGVTQLNRLAAHPPF 34 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 70.5 bits (165), Expect = 3e-12 Identities = 33/49 (67%), Positives = 34/49 (69%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGK + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 11 FYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 Score = 49.6 bits (113), Expect = 6e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +3 Query: 642 LQFHWPSFYNRRDWENPGVTQLNRLAAHXPF 734 + HWPSFYN +N GVTQLNRLAAH PF Sbjct: 4 ITIHWPSFYNVVTGKNTGVTQLNRLAAHPPF 34 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 70.1 bits (164), Expect = 4e-12 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = +1 Query: 673 VVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 VVTGKT + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 14 VVTGKTPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 666 YNRRDWENPGVTQLNRLAAHXPF 734 YN + PGVTQLNRLAAH PF Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPF 34 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 69.7 bits (163), Expect = 6e-12 Identities = 33/49 (67%), Positives = 34/49 (69%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGK + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 11 FYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 Score = 52.8 bits (121), Expect = 7e-07 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +3 Query: 642 LQFHWPSFYNRRDWENPGVTQLNRLAAHXPF 734 + HWPSFYN +NPGVTQLNRLAAH PF Sbjct: 4 ITIHWPSFYNVVTGKNPGVTQLNRLAAHPPF 34 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 68.1 bits (159), Expect = 2e-11 Identities = 32/49 (65%), Positives = 33/49 (67%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F TGKTLA L L PPFASWR S+ AR DRPSQQLR LNGEW Sbjct: 54 FYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRPSQQLRSLNGEW 102 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 642 LQFHWPSFYNRRDWENPGVTQLNRLAAHXPF 734 + HWP+FYN + TQLNRLAAH PF Sbjct: 47 ITIHWPAFYNAPTGKTLAYTQLNRLAAHPPF 77 >SB_28080| Best HMM Match : Glycolytic (HMM E-Value=0) Length = 304 Score = 67.3 bits (157), Expect = 3e-11 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 688 TLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 TL PN++ H PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 225 TLLKPNMVTAAH-PPFASWRNSEEARTDRPSQQLRSLNGEW 264 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 66.5 bits (155), Expect = 5e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 649 FTGRRFTTVVTGKTLALPNLIALQHXPPFASWRXS 753 +TGRRFTT+VTGKTLALPNLIALQH P FASWR S Sbjct: 54 WTGRRFTTLVTGKTLALPNLIALQHIPHFASWRNS 88 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 66.5 bits (155), Expect = 5e-11 Identities = 33/50 (66%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = +1 Query: 664 FTTVVTGKTLAL-PNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VVTGK P+L LQ+ P ASWR SE ARTDRPSQQLR LNGEW Sbjct: 11 FYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRPSQQLRSLNGEW 60 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 65.7 bits (153), Expect = 9e-11 Identities = 31/49 (63%), Positives = 33/49 (67%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F V+ KT + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 11 FYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLNGEW 59 Score = 49.6 bits (113), Expect = 6e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +3 Query: 642 LQFHWPSFYNRRDWENPGVTQLNRLAAHXPF 734 + HWPSFYN + PGVTQLNRLAAH PF Sbjct: 4 ITIHWPSFYNVMLAKTPGVTQLNRLAAHPPF 34 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 64.9 bits (151), Expect = 2e-10 Identities = 33/49 (67%), Positives = 35/49 (71%) Frame = -3 Query: 810 PFAIQXAQLLGRAIGAGLFAXTPAGERGXVLQGD*VG*RQGFPSHDGCK 664 PFAIQ AQLLGRAIGAGLFA TPAGERG + +G FPSHD K Sbjct: 4 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVK 52 Score = 49.2 bits (112), Expect = 8e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -1 Query: 728 GMCCKAIKLGNARVFPVTTVVKRRPV 651 GMCCKAIKLGNA VFP VVKRRPV Sbjct: 31 GMCCKAIKLGNASVFPSHDVVKRRPV 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 649 NCNTTHYRAXW 617 NCNTTHYRA W Sbjct: 57 NCNTTHYRANW 67 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 64.5 bits (150), Expect = 2e-10 Identities = 33/53 (62%), Positives = 35/53 (66%) Frame = +1 Query: 652 TGRRFTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 TGRRFT + + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 40 TGRRFTRR-DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 91 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 64.5 bits (150), Expect = 2e-10 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 642 LQFHWPSFYNRRDWENPGVTQLNRLAAHXPF 734 + HWPSFY RRDWENPGV QLNRLAAH PF Sbjct: 25 ITIHWPSFYKRRDWENPGVNQLNRLAAHPPF 55 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRSSEEARTDRPSQQLRRLNGEW 80 >SB_28437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 62.9 bits (146), Expect = 6e-10 Identities = 29/44 (65%), Positives = 30/44 (68%) Frame = +1 Query: 679 TGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 T +ALP PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 43 TNHCIALPRSSKKGTHPPFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_14096| Best HMM Match : DUF595 (HMM E-Value=2.1) Length = 233 Score = 62.9 bits (146), Expect = 6e-10 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLGNARV 687 HSPFR RNCWEGRSVRA SL RQLAKGG C A +L ARV Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGG--CAARRLSWARV 70 >SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 62.5 bits (145), Expect = 9e-10 Identities = 30/47 (63%), Positives = 31/47 (65%) Frame = +1 Query: 670 TVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 TV T T + L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 2 TVKTSDTCSSRRRSQLVSHPPFASWRNSEEARTDRPSQQLRSLNGEW 48 >SB_25110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 62.5 bits (145), Expect = 9e-10 Identities = 30/47 (63%), Positives = 31/47 (65%) Frame = +1 Query: 670 TVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 TV T T + L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 2 TVKTSDTCSSRRRSQLVSHPPFASWRNSEEARTDRPSQQLRSLNGEW 48 >SB_17822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 62.5 bits (145), Expect = 9e-10 Identities = 30/47 (63%), Positives = 31/47 (65%) Frame = +1 Query: 670 TVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 TV T T + L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 2 TVKTSDTCSSRRRSQLVSHPPFASWRNSEEARTDRPSQQLRSLNGEW 48 >SB_10411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 62.5 bits (145), Expect = 9e-10 Identities = 30/47 (63%), Positives = 31/47 (65%) Frame = +1 Query: 670 TVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 TV T T + L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 2 TVKTSDTCSSRRRSQLVSHPPFASWRNSEEARTDRPSQQLRSLNGEW 48 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 62.1 bits (144), Expect = 1e-09 Identities = 28/43 (65%), Positives = 30/43 (69%) Frame = +1 Query: 682 GKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 G+ + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 38 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 40.3 bits (90), Expect = 0.004 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRD EN GVTQLNRLAAH PF Sbjct: 35 RRDGENTGVTQLNRLAAHPPF 55 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 62.1 bits (144), Expect = 1e-09 Identities = 30/49 (61%), Positives = 32/49 (65%) Frame = +1 Query: 664 FTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 F VV + + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 11 FYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 Score = 59.7 bits (138), Expect = 6e-09 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 642 LQFHWPSFYNRRDWENPGVTQLNRLAAHXPF 734 + HWPSFYN WENPGVTQLNRLAAH PF Sbjct: 4 ITIHWPSFYNVVHWENPGVTQLNRLAAHPPF 34 >SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) Length = 272 Score = 62.1 bits (144), Expect = 1e-09 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -2 Query: 808 IRHSGCATVGKGDRCGPXRXYASWRKG 728 IRHSGCATVGKGDRCGP R YASWRKG Sbjct: 240 IRHSGCATVGKGDRCGPLRYYASWRKG 266 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 62.1 bits (144), Expect = 1e-09 Identities = 28/43 (65%), Positives = 30/43 (69%) Frame = +1 Query: 682 GKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 G+ + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 63 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 105 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/41 (60%), Positives = 27/41 (65%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRD EN GVTQLNRLAAH PF Sbjct: 40 VELQFALYESYYNSLAVVLQRRDGENTGVTQLNRLAAHPPF 80 >SB_17772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 62.1 bits (144), Expect = 1e-09 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 694 ALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 A P + ++ PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 9 ANPIAVTVKPHPPFASWRNSEEARTDRPSQQLRSLNGEW 47 >SB_16329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 62.1 bits (144), Expect = 1e-09 Identities = 29/51 (56%), Positives = 33/51 (64%) Frame = +1 Query: 658 RRFTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 R+ V+ + L N + PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 6 RKLQFQVSRNVVTLTNDNEFEAHPPFASWRNSEEARTDRPSQQLRSLNGEW 56 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 62.1 bits (144), Expect = 1e-09 Identities = 28/43 (65%), Positives = 30/43 (69%) Frame = +1 Query: 682 GKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 G+ + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 704 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 746 Score = 40.3 bits (90), Expect = 0.004 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRD EN GVTQLNRLAAH PF Sbjct: 701 RRDGENTGVTQLNRLAAHPPF 721 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 62.1 bits (144), Expect = 1e-09 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -2 Query: 808 IRHSGCATVGKGDRCGPXRXYASWRKG 728 IRHSGCATVGKGDRCGP R YASWRKG Sbjct: 86 IRHSGCATVGKGDRCGPLRYYASWRKG 112 Score = 59.3 bits (137), Expect = 8e-09 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAI 708 HSPFR RNCWEGRSVRA SL RQLAKGG + + Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 52 Score = 47.2 bits (107), Expect = 3e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 733 KGXCAARRLSWVTPGFSQSRR 671 KG CAARRLSWVTPGFSQSRR Sbjct: 44 KGGCAARRLSWVTPGFSQSRR 64 >SB_2380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 62.1 bits (144), Expect = 1e-09 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = +1 Query: 715 LQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 LQ PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 21 LQAHPPFASWRNSEEARTDRPSQQLRSLNGEW 52 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 62.1 bits (144), Expect = 1e-09 Identities = 28/43 (65%), Positives = 30/43 (69%) Frame = +1 Query: 682 GKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 G+ + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 75 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 117 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/41 (60%), Positives = 27/41 (65%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRD EN GVTQLNRLAAH PF Sbjct: 52 VELQFALYESYYNSLAVVLQRRDGENTGVTQLNRLAAHPPF 92 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 62.1 bits (144), Expect = 1e-09 Identities = 32/63 (50%), Positives = 39/63 (61%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEWXNCKR*YFVKIRVXFLVKSAHF*PIGRNRQIP 906 PPFASWR SE ARTDRPSQQLR LNGEW + YF+ + L+ + I N ++ Sbjct: 461 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMR--YFLLTHLCVLMTAVMIPLIASNVKVD 518 Query: 907 XKI 915 KI Sbjct: 519 IKI 521 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 443 RRDWENPGVTQLNRLAAHPPF 463 >SB_17408| Best HMM Match : I-set (HMM E-Value=7.4e-06) Length = 136 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 694 ALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 A+ +I + PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 86 AVATIIDVYTHPPFASWRNSEEARTDRPSQQLRSLNGEW 124 >SB_55190| Best HMM Match : UCR_TM (HMM E-Value=8.9) Length = 89 Score = 61.3 bits (142), Expect = 2e-09 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +1 Query: 691 LALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 +ALP +A PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 13 VALPAAVA---HPPFASWRNSEEARTDRPSQQLRSLNGEW 49 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 61.3 bits (142), Expect = 2e-09 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 2/42 (4%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW--XNCKR*YFVKIR 846 PPFASWR SE ARTDRPSQQLR LNGEW C + Y ++R Sbjct: 77 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCGQNYTTRLR 118 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 59 RRDWENPGVTQLNRLAAHPPF 79 >SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 61.3 bits (142), Expect = 2e-09 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = +1 Query: 685 KTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 K + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 18 KNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 Score = 44.0 bits (99), Expect = 3e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDW+N GVTQLNRLAAH PF Sbjct: 14 RRDWKNTGVTQLNRLAAHPPF 34 >SB_25859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 700 PNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 P++ H PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 23 PDIFQKSH-PPFASWRNSEEARTDRPSQQLRSLNGEW 58 >SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = +1 Query: 700 PNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 P L+ PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 62 PPAETLEAHPPFASWRNSEEARTDRPSQQLRSLNGEW 98 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -1 Query: 791 RNCWEGRSVRAXSLXRQLAKGGMCCKAI 708 RNCWEGRSVRA SL RQLAKGG + + Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRL 30 Score = 47.2 bits (107), Expect = 3e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 733 KGXCAARRLSWVTPGFSQSRR 671 KG CAARRLSWVTPGFSQSRR Sbjct: 22 KGGCAARRLSWVTPGFSQSRR 42 >SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) Length = 1173 Score = 61.3 bits (142), Expect = 2e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLGNA 693 HSPFR RNCWEGRSVRA SL RQLAKGG + + N+ Sbjct: 72 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWANS 110 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 61.3 bits (142), Expect = 2e-09 Identities = 28/43 (65%), Positives = 30/43 (69%) Frame = +1 Query: 682 GKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 G+ + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 38 GENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRD ENPGVTQLNRLAAH PF Sbjct: 35 RRDGENPGVTQLNRLAAHPPF 55 >SB_15159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 61.3 bits (142), Expect = 2e-09 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = +1 Query: 685 KTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 K + L L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 62 KNTGVSQLNRLAVHPPFASWRSSEEARTDRPSQQLRSLNGEW 103 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/41 (56%), Positives = 27/41 (65%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDW+N GV+QLNRLA H PF Sbjct: 38 VELQFALYESYYNSLAVVLQRRDWKNTGVSQLNRLAVHPPF 78 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 60.9 bits (141), Expect = 3e-09 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLG 699 HSPFR RNCWEGRSVRA SL RQLAKGG + + G Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 440 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 1214 PPFASWRNSEEARTDRPSQQLRSLNGEW 1241 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 1196 RRDWENPGVTQLNRLAAHPPF 1216 >SB_40748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 60.9 bits (141), Expect = 3e-09 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = +1 Query: 679 TGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 +G L + ++ H PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 25 SGIPLTAQSAYSIAH-PPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 60.9 bits (141), Expect = 3e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 715 LQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 L+ PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 86 LEAHPPFASWRNSEEARTDRPSQQLRSLNGEW 117 Score = 39.9 bits (89), Expect = 0.005 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 R DW+NPGVT LNRL AH PF Sbjct: 72 RLDWKNPGVTPLNRLEAHPPF 92 >SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) Length = 912 Score = 60.9 bits (141), Expect = 3e-09 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLG 699 HSPFR RNCWEGRSVRA SL RQLAKGG + + G Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 68 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 60.9 bits (141), Expect = 3e-09 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLG 699 HSPFR RNCWEGRSVRA SL RQLAKGG + + G Sbjct: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 655 >SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) Length = 949 Score = 60.9 bits (141), Expect = 3e-09 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLG 699 HSPFR RNCWEGRSVRA SL RQLAKGG + + G Sbjct: 71 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 107 Score = 59.3 bits (137), Expect = 8e-09 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAI 708 HSPFR RNCWEGRSVRA SL RQLAKGG + + Sbjct: 395 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 428 >SB_39908| Best HMM Match : Prismane (HMM E-Value=3) Length = 456 Score = 60.9 bits (141), Expect = 3e-09 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLG 699 HSPFR RNCWEGRSVRA SL RQLAKGG + + G Sbjct: 321 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 357 Score = 56.0 bits (129), Expect = 7e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 810 PFAIQXAQLLGRAIGAGLFAXTPAGERG 727 PFAIQ AQLLGRAIGAGLFA TPAGERG Sbjct: 4 PFAIQAAQLLGRAIGAGLFAITPAGERG 31 >SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 60.9 bits (141), Expect = 3e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 709 IALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 +A + PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 1 MAAETHPPFASWRNSEEARTDRPSQQLRSLNGEW 34 >SB_17057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 60.9 bits (141), Expect = 3e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 715 LQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 L+ PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 46 LEAHPPFASWRNSEEARTDRPSQQLRSLNGEW 77 >SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.9 bits (141), Expect = 3e-09 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +1 Query: 709 IALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 + Q PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 34 VCRQAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 60.9 bits (141), Expect = 3e-09 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLG 699 HSPFR RNCWEGRSVRA SL RQLAKGG + + G Sbjct: 207 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 243 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 60.5 bits (140), Expect = 3e-09 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEWXNCKR 825 PPFASWR SE ARTDRPSQQLR LNGEW +R Sbjct: 124 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRR 156 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 106 RRDWENPGVTQLNRLAAHPPF 126 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 60.5 bits (140), Expect = 3e-09 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +3 Query: 642 LQFHWPSFYNRRDWENPGVTQLNRLAAHXPF 734 + HWPS RRDWENPGVTQLNRLAAH PF Sbjct: 280 ITIHWPSVLQRRDWENPGVTQLNRLAAHPPF 310 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 308 PPFASWRNSEEARTDRPSQQLRSLNGEW 335 >SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) Length = 1710 Score = 60.5 bits (140), Expect = 3e-09 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLGNARVFP--VTTV 669 HSPFR RNCWEGRSVRA SL RQLAKGG + + + P VTTV Sbjct: 769 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWDILQNIPGHVTTV 817 >SB_30030| Best HMM Match : GATA-N (HMM E-Value=3.8) Length = 160 Score = 60.5 bits (140), Expect = 3e-09 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 718 QHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 Q PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 91 QAHPPFASWRNSEEARTDRPSQQLRSLNGEW 121 >SB_9678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 60.5 bits (140), Expect = 3e-09 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 718 QHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 Q PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 46 QAHPPFASWRNSEEARTDRPSQQLRSLNGEW 76 >SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 60.5 bits (140), Expect = 3e-09 Identities = 30/51 (58%), Positives = 31/51 (60%) Frame = +1 Query: 658 RRFTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 RR T + K L PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 41 RRCKTTASAKLACLQVDSRGSPHPPFASWRNSEEARTDRPSQQLRSLNGEW 91 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -1 Query: 791 RNCWEGRSVRAXSLXRQLAKGGMCCKAI 708 RNCWEGRSVRA SL RQLAKGG + + Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRL 30 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 733 KGXCAARRLSWVTPGFSQSRR 671 KG CAARRLSWVTP FSQSRR Sbjct: 22 KGGCAARRLSWVTPVFSQSRR 42 >SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 60.5 bits (140), Expect = 3e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 715 LQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 L+ PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 86 LRTHPPFASWRNSEEARTDRPSQQLRSLNGEW 117 >SB_27699| Best HMM Match : Sulfotransfer_1 (HMM E-Value=0.51) Length = 149 Score = 60.5 bits (140), Expect = 3e-09 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 718 QHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 Q PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 80 QAHPPFASWRNSEEARTDRPSQQLRSLNGEW 110 >SB_24420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 60.5 bits (140), Expect = 3e-09 Identities = 31/47 (65%), Positives = 33/47 (70%), Gaps = 4/47 (8%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIK---LGNA-RVFP 681 HSPFR RNCWEGRSVRA SL RQLAKGG + + L NA R FP Sbjct: 74 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWLALQNALRYFP 120 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 60.5 bits (140), Expect = 3e-09 Identities = 36/65 (55%), Positives = 41/65 (63%) Frame = -3 Query: 810 PFAIQXAQLLGRAIGAGLFAXTPAGERGXVLQGD*VG*RQGFPSHDGCKTTASEIVIRLT 631 PFAIQ AQLLGRAIGAGLFA TPAGERG + +G + FP KTTAS + L Sbjct: 11 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPV-TTFKTTASAKLACLQ 69 Query: 630 IGRXG 616 + G Sbjct: 70 VDSRG 74 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 60.1 bits (139), Expect = 5e-09 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -1 Query: 809 HSPFRXRNCWEGRSVRAXSLXRQLAKGGMCCKAIKLGNA 693 HSPFR RNCWEGRSVRA SL RQLAKGG + + A Sbjct: 626 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWSTA 664 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 733 KGXCAARRLSWVTPG 689 KG CAARRLSW T G Sbjct: 651 KGGCAARRLSWSTAG 665 >SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) Length = 93 Score = 60.1 bits (139), Expect = 5e-09 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 709 IALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 + + PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 21 LVISAHPPFASWRNSEEARTDRPSQQLRSLNGEW 54 >SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) Length = 143 Score = 60.1 bits (139), Expect = 5e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 709 IALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 +A+ PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 70 MAVGAHPPFASWRNSEEARTDRPSQQLRSLNGEW 103 >SB_31314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 60.1 bits (139), Expect = 5e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRSSEQARTDRPSQQLRTLNGEW 80 Score = 43.2 bits (97), Expect = 6e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWEN GVT LNRLAAH PF Sbjct: 35 RRDWENTGVTPLNRLAAHPPF 55 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 60.1 bits (139), Expect = 5e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 244 PPFASWRTSEEARTDRPSQQLRSLNGEW 271 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 226 RRDWENPGVTQLNRLAAHPPF 246 >SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 60.1 bits (139), Expect = 5e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 35 PPFASWRSSEEARTDRPSQQLRSLNGEW 62 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 17 RRDWENPGVTQLNRLAAHPPF 37 >SB_40757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 60.1 bits (139), Expect = 5e-09 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 709 IALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 + ++ PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 20 LIIRAHPPFASWRNSEEARTDRPSQQLRSLNGEW 53 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 60.1 bits (139), Expect = 5e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEWXNCKR*YFVKI 843 PPFASWR SE ARTDRPSQQLR LNGEW + Y + + Sbjct: 553 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRARYTITL 591 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 535 RRDWENPGVTQLNRLAAHPPF 555 >SB_25902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 60.1 bits (139), Expect = 5e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 32 PPFASWRSSEEARTDRPSQQLRSLNGEW 59 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWEN GVTQLNRLAAH PF Sbjct: 14 RRDWENTGVTQLNRLAAHPPF 34 >SB_23802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 60.1 bits (139), Expect = 5e-09 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = +1 Query: 691 LALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 + L I PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 100 IGLDGSIGCLAHPPFASWRNSEEARTDRPSQQLRSLNGEW 139 >SB_19333| Best HMM Match : RNase_P_Rpp14 (HMM E-Value=0.042) Length = 168 Score = 60.1 bits (139), Expect = 5e-09 Identities = 29/53 (54%), Positives = 31/53 (58%) Frame = +1 Query: 652 TGRRFTTVVTGKTLALPNLIALQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 T F + + L H PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 78 TSLTFVKSINNRACMFKTLYIGAH-PPFASWRNSEEARTDRPSQQLRSLNGEW 129 >SB_6227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 60.1 bits (139), Expect = 5e-09 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 715 LQHXPPFASWRXSEXARTDRPSQQLRXLNGEW 810 ++ PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 56 MEAHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_3997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 60.1 bits (139), Expect = 5e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 32 PPFASWRSSEEARTDRPSQQLRSLNGEW 59 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWEN GVTQLNRLAAH PF Sbjct: 14 RRDWENTGVTQLNRLAAHPPF 34 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 59 PPFASWRNSEEARTDRPSQQLRSLNGEW 86 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 21 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 61 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 39 PPFASWRNSEEARTDRPSQQLRSLNGEW 66 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 21 RRDWENPGVTQLNRLAAHPPF 41 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 86 PPFASWRNSEEARTDRPSQQLRSLNGEW 113 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 68 RRDWENPGVTQLNRLAAHPPF 88 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 68 PPFASWRNSEEARTDRPSQQLRSLNGEW 95 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 50 RRDWENPGVTQLNRLAAHPPF 70 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 60 PPFASWRNSEEARTDRPSQQLRSLNGEW 87 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 22 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 62 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 86 PPFASWRNSEEARTDRPSQQLRSLNGEW 113 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 48 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 88 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 66 PPFASWRNSEEARTDRPSQQLRSLNGEW 93 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWEN GVTQLNRLAAH PF Sbjct: 48 RRDWENTGVTQLNRLAAHPPF 68 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 91 PPFASWRNSEEARTDRPSQQLRSLNGEW 118 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 73 RRDWENPGVTQLNRLAAHPPF 93 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 62 PPFASWRNSEEARTDRPSQQLRSLNGEW 89 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 24 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 64 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNGEW 109 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 64 RRDWENPGVTQLNRLAAHPPF 84 >SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) Length = 751 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 501 PPFASWRNSEEARTDRPSQQLRSLNGEW 528 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 94 PPFASWRNSEEARTDRPSQQLRSLNGEW 121 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 56 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 96 >SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 32 PPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 70 PPFASWRNSEEARTDRPSQQLRSLNGEW 97 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 32 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 72 >SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 59 PPFASWRNSEEARTDRPSQQLRSLNGEW 86 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 41 RRDWENPGVTQLNRLAAHPPF 61 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 49 PPFASWRNSEEARTDRPSQQLRSLNGEW 76 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 31 RRDWENPGVTQLNRLAAHPPF 51 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 74 PPFASWRNSEEARTDRPSQQLRSLNGEW 101 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 56 RRDWENPGVTQLNRLAAHPPF 76 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 83 PPFASWRNSEEARTDRPSQQLRSLNGEW 110 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 65 RRDWENPGVTQLNRLAAHPPF 85 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 77 PPFASWRNSEEARTDRPSQQLRSLNGEW 104 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 39 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 79 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNGEW 120 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 55 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 95 >SB_58562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 81 PPFASWRNSEEARTDRPSQQLRSLNGEW 108 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 43 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 83 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 64 PPFASWRNSEEARTDRPSQQLRSLNGEW 91 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 46 RRDWENPGVTQLNRLAAHPPF 66 >SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWEN GVTQLNRLAAH PF Sbjct: 35 RRDWENTGVTQLNRLAAHPPF 55 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 240 PPFASWRNSEEARTDRPSQQLRSLNGEW 267 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 222 RRDWENPGVTQLNRLAAHPPF 242 >SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 135 PPFASWRNSEEARTDRPSQQLRSLNGEW 162 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 117 RRDWENPGVTQLNRLAAHPPF 137 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 73 PPFASWRNSEEARTDRPSQQLRSLNGEW 100 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 55 RRDWENPGVTQLNRLAAHPPF 75 >SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 52 PPFASWRNSEEARTDRPSQQLRSLNGEW 79 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 34 RRDWENPGVTQLNRLAAHPPF 54 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEW 67 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 22 RRDWENPGVTQLNRLAAHPPF 42 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 71 PPFASWRNSEEARTDRPSQQLRSLNGEW 98 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 53 RRDWENPGVTQLNRLAAHPPF 73 >SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 405 PPFASWRNSEEARTDRPSQQLRSLNGEW 432 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 387 RRDWENPGVTQLNRLAAHPPF 407 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 131 PPFASWRNSEEARTDRPSQQLRSLNGEW 158 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 113 RRDWENPGVTQLNRLAAHPPF 133 >SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 107 PPFASWRNSEEARTDRPSQQLRSLNGEW 134 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 69 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 109 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNGEW 90 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 45 RRDWENPGVTQLNRLAAHPPF 65 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 32 PPFASWRNSEEARTDRPSQQLRSLNGEW 59 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 14 RRDWENPGVTQLNRLAAHPPF 34 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 42 PPFASWRNSEEARTDRPSQQLRSLNGEW 69 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 24 RRDWENPGVTQLNRLAAHPPF 44 >SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 62 PPFASWRNSEEARTDRPSQQLRSLNGEW 89 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 44 RRDWENPGVTQLNRLAAHPPF 64 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 127 PPFASWRNSEEARTDRPSQQLRSLNGEW 154 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 89 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 129 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 69 PPFASWRNSEEARTDRPSQQLRSLNGEW 96 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 51 RRDWENPGVTQLNRLAAHPPF 71 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 364 PPFASWRNSEEARTDRPSQQLRSLNGEW 391 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 346 RRDWENPGVTQLNRLAAHPPF 366 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 104 PPFASWRNSEEARTDRPSQQLRSLNGEW 131 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 86 RRDWENPGVTQLNRLAAHPPF 106 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 74 PPFASWRNSEEARTDRPSQQLRSLNGEW 101 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 56 RRDWENPGVTQLNRLAAHPPF 76 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEW 67 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 22 RRDWENPGVTQLNRLAAHPPF 42 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 83 PPFASWRNSEEARTDRPSQQLRSLNGEW 110 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 65 RRDWENPGVTQLNRLAAHPPF 85 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 67 PPFASWRNSEEARTDRPSQQLRSLNGEW 94 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 49 RRDWENPGVTQLNRLAAHPPF 69 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 158 PPFASWRNSEEARTDRPSQQLRSLNGEW 185 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 140 RRDWENPGVTQLNRLAAHPPF 160 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 87 PPFASWRNSEEARTDRPSQQLRSLNGEW 114 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 69 RRDWENPGVTQLNRLAAHPPF 89 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNGEW 90 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 45 RRDWENPGVTQLNRLAAHPPF 65 >SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 167 PPFASWRNSEEARTDRPSQQLRSLNGEW 194 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 129 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 169 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 857 PPFASWRNSEEARTDRPSQQLRSLNGEW 884 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 839 RRDWENPGVTQLNRLAAHPPF 859 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEW 67 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 22 RRDWENPGVTQLNRLAAHPPF 42 >SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 84 PPFASWRNSEEARTDRPSQQLRSLNGEW 111 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 46 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 86 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEW 85 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 20 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNGEW 124 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 59 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 99 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 59 PPFASWRNSEEARTDRPSQQLRSLNGEW 86 Score = 46.4 bits (105), Expect = 6e-05 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWEN GVTQLNRLAAH PF Sbjct: 21 VELQFALYESYYNSLAVVLQRRDWENTGVTQLNRLAAHPPF 61 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 80 PPFASWRNSEEARTDRPSQQLRSLNGEW 107 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 42 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 82 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNGEW 120 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 55 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 95 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 89 PPFASWRNSEEARTDRPSQQLRSLNGEW 116 Score = 46.8 bits (106), Expect = 5e-05 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN R DWENPGVTQLNRLAAH PF Sbjct: 51 VELQFALYESYYNSLAVVLQRLDWENPGVTQLNRLAAHPPF 91 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 280 PPFASWRNSEEARTDRPSQQLRSLNGEW 307 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 262 RRDWENPGVTQLNRLAAHPPF 282 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWEN GVTQLNRLAAH PF Sbjct: 35 RRDWENTGVTQLNRLAAHPPF 55 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 138 PPFASWRNSEEARTDRPSQQLRSLNGEW 165 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 120 RRDWENPGVTQLNRLAAHPPF 140 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 74 PPFASWRNSEEARTDRPSQQLRSLNGEW 101 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 36 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 76 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 60 PPFASWRNSEEARTDRPSQQLRSLNGEW 87 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 42 RRDWENPGVTQLNRLAAHPPF 62 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNGEW 88 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 23 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 63 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 125 PPFASWRNSEEARTDRPSQQLRSLNGEW 152 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 87 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 127 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 138 PPFASWRNSEEARTDRPSQQLRSLNGEW 165 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 120 RRDWENPGVTQLNRLAAHPPF 140 >SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNGEW 90 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 45 RRDWENPGVTQLNRLAAHPPF 65 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEW 71 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 26 RRDWENPGVTQLNRLAAHPPF 46 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNGEW 109 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 44 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 84 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNGEW 88 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 43 RRDWENPGVTQLNRLAAHPPF 63 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEW 85 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 40 RRDWENPGVTQLNRLAAHPPF 60 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 35 PPFASWRNSEEARTDRPSQQLRSLNGEW 62 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 17 RRDWENPGVTQLNRLAAHPPF 37 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 43 PPFASWRNSEEARTDRPSQQLRSLNGEW 70 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 25 RRDWENPGVTQLNRLAAHPPF 45 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 420 PPFASWRNSEEARTDRPSQQLRSLNGEW 447 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 402 RRDWENPGVTQLNRLAAHPPF 422 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 69 PPFASWRNSEEARTDRPSQQLRSLNGEW 96 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 31 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 71 >SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 78 PPFASWRNSEEARTDRPSQQLRSLNGEW 105 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 40 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 80 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 60 PPFASWRNSEEARTDRPSQQLRSLNGEW 87 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 22 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 62 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 143 PPFASWRNSEEARTDRPSQQLRSLNGEW 170 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 125 RRDWENPGVTQLNRLAAHPPF 145 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 79 PPFASWRNSEEARTDRPSQQLRSLNGEW 106 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 41 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 81 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 89 PPFASWRNSEEARTDRPSQQLRSLNGEW 116 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 51 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 91 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 92 PPFASWRNSEEARTDRPSQQLRSLNGEW 119 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 54 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 94 >SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 438 PPFASWRNSEEARTDRPSQQLRSLNGEW 465 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 420 RRDWENPGVTQLNRLAAHPPF 440 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 135 PPFASWRNSEEARTDRPSQQLRSLNGEW 162 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 97 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 137 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 91 PPFASWRNSEEARTDRPSQQLRSLNGEW 118 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 53 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 93 >SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 80 PPFASWRNSEEARTDRPSQQLRSLNGEW 107 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 62 RRDWENPGVTQLNRLAAHPPF 82 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 70 PPFASWRNSEEARTDRPSQQLRSLNGEW 97 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 52 RRDWENPGVTQLNRLAAHPPF 72 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWEN GVTQLNRLAAH PF Sbjct: 35 RRDWENTGVTQLNRLAAHPPF 55 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 185 PPFASWRNSEEARTDRPSQQLRSLNGEW 212 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 147 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 187 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 89 PPFASWRNSEEARTDRPSQQLRSLNGEW 116 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 51 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 91 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 76 PPFASWRNSEEARTDRPSQQLRSLNGEW 103 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 38 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 78 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 112 PPFASWRNSEEARTDRPSQQLRSLNGEW 139 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 94 RRDWENPGVTQLNRLAAHPPF 114 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 78 PPFASWRNSEEARTDRPSQQLRSLNGEW 105 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWEN GVTQLNRLAAH PF Sbjct: 60 RRDWENTGVTQLNRLAAHPPF 80 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNGEW 88 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 43 RRDWENPGVTQLNRLAAHPPF 63 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 87 PPFASWRNSEEARTDRPSQQLRSLNGEW 114 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 69 RRDWENPGVTQLNRLAAHPPF 89 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 3 PPFASWRNSEEARTDRPSQQLRSLNGEW 30 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 66 PPFASWRNSEEARTDRPSQQLRSLNGEW 93 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 28 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 68 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) Length = 129 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 62 PPFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 209 PPFASWRNSEEARTDRPSQQLRSLNGEW 236 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 191 RRDWENPGVTQLNRLAAHPPF 211 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEW 85 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 40 RRDWENPGVTQLNRLAAHPPF 60 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 64 PPFASWRNSEEARTDRPSQQLRSLNGEW 91 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 46 RRDWENPGVTQLNRLAAHPPF 66 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 78 PPFASWRNSEEARTDRPSQQLRSLNGEW 105 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 60 RRDWENPGVTQLNRLAAHPPF 80 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 75 PPFASWRNSEEARTDRPSQQLRSLNGEW 102 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 57 RRDWENPGVTQLNRLAAHPPF 77 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) Length = 146 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 80 PPFASWRNSEEARTDRPSQQLRSLNGEW 107 Score = 44.8 bits (101), Expect = 2e-04 Identities = 25/41 (60%), Positives = 27/41 (65%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWEN GVTQLNRLA H PF Sbjct: 42 VELQFALYESYYNSLAVVLQRRDWENTGVTQLNRLAVHPPF 82 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEW 85 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 20 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 60 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 59 PPFASWRNSEEARTDRPSQQLRSLNGEW 86 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 41 RRDWENPGVTQLNRLAAHPPF 61 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 73 PPFASWRNSEEARTDRPSQQLRSLNGEW 100 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 55 RRDWENPGVTQLNRLAAHPPF 75 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNGEW 90 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 45 RRDWENPGVTQLNRLAAHPPF 65 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 156 PPFASWRNSEEARTDRPSQQLRSLNGEW 183 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 138 RRDWENPGVTQLNRLAAHPPF 158 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 65 PPFASWRNSEEARTDRPSQQLRSLNGEW 92 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 8/41 (19%) Frame = +3 Query: 636 VVLQFH-WPSFYN-------RRDWENPGVTQLNRLAAHXPF 734 V LQF + S+YN RRDWENPGVTQLNRLAAH PF Sbjct: 27 VELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 67 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 108 PPFASWRNSEEARTDRPSQQLRSLNGEW 135 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 90 RRDWENPGVTQLNRLAAHPPF 110 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 46 PPFASWRNSEEARTDRPSQQLRSLNGEW 73 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 28 RRDWENPGVTQLNRLAAHPPF 48 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEW 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 35 RRDWENPGVTQLNRLAAHPPF 55 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 177 PPFASWRNSEEARTDRPSQQLRSLNGEW 204 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 159 RRDWENPGVTQLNRLAAHPPF 179 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 59.7 bits (138), Expect = 6e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 727 PPFASWRXSEXARTDRPSQQLRXLNGEW 810 PPFASWR SE ARTDRPSQQLR LNGEW Sbjct: 364 PPFASWRNSEEARTDRPSQQLRSLNGEW 391 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 672 RRDWENPGVTQLNRLAAHXPF 734 RRDWENPGVTQLNRLAAH PF Sbjct: 346 RRDWENPGVTQLNRLAAHPPF 366 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,645,111 Number of Sequences: 59808 Number of extensions: 574422 Number of successful extensions: 8004 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7956 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4894653009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -