BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_C06_e523_06.seq (1550 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79210.1 68414.m09235 20S proteasome alpha subunit B, putativ... 71 2e-12 At1g16470.1 68414.m01970 20S proteasome alpha subunit B (PAB1) (... 71 2e-12 At2g05840.1 68415.m00632 20S proteasome alpha subunit A2 (PAA2) ... 38 0.024 At5g35590.1 68418.m04237 20S proteasome alpha subunit A1 (PAA1) ... 36 0.072 At3g14290.1 68416.m01808 20S proteasome alpha subunit E2 (PAE2) ... 36 0.095 At1g53850.1 68414.m06129 20S proteasome alpha subunit E1 (PAE1) ... 36 0.095 At3g22110.1 68416.m02791 20S proteasome alpha subunit C (PAC1) (... 35 0.13 At5g66140.1 68418.m08332 20S proteasome alpha subunit D2 (PAD2) ... 34 0.22 At3g51260.1 68416.m05611 20S proteasome alpha subunit D (PAD1) 34 0.22 At2g27020.1 68415.m03244 20S proteasome alpha subunit G (PAG1) (... 32 1.2 At5g42790.1 68418.m05212 20S proteasome alpha subunit F1 (PAF1) ... 30 3.6 At1g47250.1 68414.m05231 20S proteasome alpha subunit F2 (PAF2) ... 30 3.6 >At1g79210.1 68414.m09235 20S proteasome alpha subunit B, putative nearly identical to SP|O23708 Proteasome subunit alpha type 2 (EC 3.4.25.1) (20S proteasome alpha subunit B) {Arabidopsis thaliana} and to At1g16470 Length = 235 Score = 70.9 bits (166), Expect = 2e-12 Identities = 40/62 (64%), Positives = 44/62 (70%) Frame = +3 Query: 33 GSERYSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATENKHKSILYDEH 212 G +YSFSLTTFSPSGKLV L + + G TS+GI ASNGVVIATE K SIL DE Sbjct: 2 GDSQYSFSLTTFSPSGKLVQIEHALTAVGS-GQTSLGIKASNGVVIATEKKLPSILVDEA 60 Query: 213 SV 218 SV Sbjct: 61 SV 62 Score = 64.5 bits (150), Expect = 2e-10 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = +2 Query: 257 VYSGMXPDYRXLVXQAXKMXQQYYLLXHEPIPXXXMVQRVATVMXEYTQSGG 412 VYSGM PD+R LV ++ K +QY L EPIP +V+ ATVM E+TQSGG Sbjct: 75 VYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGG 126 >At1g16470.1 68414.m01970 20S proteasome alpha subunit B (PAB1) (PRC3) identical to proteasome subunit alpha type 2 SP:O23708, GI:6093778; identical to cDNA proteasome subunit prc3 GI:2511573 Length = 235 Score = 70.9 bits (166), Expect = 2e-12 Identities = 40/62 (64%), Positives = 44/62 (70%) Frame = +3 Query: 33 GSERYSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATENKHKSILYDEH 212 G +YSFSLTTFSPSGKLV L + + G TS+GI ASNGVVIATE K SIL DE Sbjct: 2 GDSQYSFSLTTFSPSGKLVQIEHALTAVGS-GQTSLGIKASNGVVIATEKKLPSILVDEA 60 Query: 213 SV 218 SV Sbjct: 61 SV 62 Score = 64.9 bits (151), Expect = 1e-10 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +2 Query: 254 MVYSGMXPDYRXLVXQAXKMXQQYYLLXHEPIPXXXMVQRVATVMXEYTQSGG 412 +VYSGM PD+R LV ++ K +QY L EPIP +V+ ATVM E+TQSGG Sbjct: 74 VVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGG 126 >At2g05840.1 68415.m00632 20S proteasome alpha subunit A2 (PAA2) identical to GB:AF043519 Length = 246 Score = 37.5 bits (83), Expect = 0.024 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +3 Query: 30 RGSER-YSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATENKHKSILYD 206 RGS Y +T FSP G+L + A G TS+G+ + V + T+ K L D Sbjct: 3 RGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLD 62 Query: 207 EHSV 218 + SV Sbjct: 63 QSSV 66 >At5g35590.1 68418.m04237 20S proteasome alpha subunit A1 (PAA1) (PRC1) identical to proteasome subunit alpha type 6-1 SP:O81146 GI:12643647 from [Arabidopsis thaliana]; identical to cDNA proteasome subunit prc1 GI:2511587 Length = 246 Score = 35.9 bits (79), Expect = 0.072 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = +3 Query: 30 RGSER-YSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATENKHKSILYD 206 RGS Y +T FSP G+L + G TS+G+ + V + T+ K L D Sbjct: 3 RGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKLLD 62 Query: 207 EHSV 218 + SV Sbjct: 63 QSSV 66 >At3g14290.1 68416.m01808 20S proteasome alpha subunit E2 (PAE2) identical to 20S proteasome subunit PAE2 GB:AAC32061 from [Arabidopsis thaliana] Length = 237 Score = 35.5 bits (78), Expect = 0.095 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +3 Query: 45 YSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATENKHKSILYDEHSV 218 Y + TFSP G+L + + G T++G+ GVV+A E + S L + SV Sbjct: 8 YDRGVNTFSPEGRLFQVEYAIEAIKL-GSTAIGVKTKEGVVLAVEKRITSPLLEPSSV 64 >At1g53850.1 68414.m06129 20S proteasome alpha subunit E1 (PAE1) identical to 20S proteasome subunit PAE1 GI:3421087 from [Arabidopsis thaliana] Length = 237 Score = 35.5 bits (78), Expect = 0.095 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +3 Query: 45 YSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATENKHKSILYDEHSV 218 Y + TFSP G+L + + G T++G+ GVV+A E + S L + SV Sbjct: 8 YDRGVNTFSPEGRLFQVEYAIEAIKL-GSTAIGVKTKEGVVLAVEKRITSPLLEPSSV 64 >At3g22110.1 68416.m02791 20S proteasome alpha subunit C (PAC1) (PRC9) identical to GB:AAC32057 from [Arabidopsis thaliana] (Genetics (1998) 149 (2), 677-692); identical to cDNA proteasome subunit prc9 GI:2511583 Length = 250 Score = 35.1 bits (77), Expect = 0.13 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +2 Query: 263 SGMXPDYRXLVXQAXKMXQQYYLLXHEPIPXXXMVQRVATVMXEYTQSGG 412 +G+ D L+ A Q+Y + EP+P +VQ + YTQ GG Sbjct: 77 AGIMSDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGG 126 Score = 34.3 bits (75), Expect = 0.22 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +3 Query: 36 SERYSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATENKHKSIL 200 S RY T FSP G+L + + + G+++GI + +GVV+ E K S L Sbjct: 2 SRRYDSRTTIFSPEGRLYQVEYAMEAI-GNAGSAIGILSKDGVVLIGEKKVTSKL 55 >At5g66140.1 68418.m08332 20S proteasome alpha subunit D2 (PAD2) (PRS1) (PRC6) identical to SP|O24616 Proteasome subunit alpha type 7-2 (EC 3.4.25.1) (20S proteasome alpha subunit D2) {Arabidopsis thaliana} Length = 250 Score = 34.3 bits (75), Expect = 0.22 Identities = 20/58 (34%), Positives = 28/58 (48%) Frame = +3 Query: 42 RYSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATENKHKSILYDEHS 215 RY ++T FSP G L L + G +VG+ ++ VV+A E K L D S Sbjct: 3 RYDRAITVFSPDGHLFQVEYALEAV-RKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRS 59 Score = 33.1 bits (72), Expect = 0.51 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +2 Query: 263 SGMXPDYRXLVXQAXKMXQQYYLLXHEPIPXXXMVQRVATVMXEYTQSGG 412 +G+ D R L+ +A Q + L +P+ + + +A + +YTQSGG Sbjct: 75 AGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGG 124 >At3g51260.1 68416.m05611 20S proteasome alpha subunit D (PAD1) Length = 250 Score = 34.3 bits (75), Expect = 0.22 Identities = 20/58 (34%), Positives = 28/58 (48%) Frame = +3 Query: 42 RYSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATENKHKSILYDEHS 215 RY ++T FSP G L L + G +VG+ ++ VV+A E K L D S Sbjct: 3 RYDRAITVFSPDGHLFQVEYALEAV-RKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRS 59 Score = 33.1 bits (72), Expect = 0.51 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +2 Query: 263 SGMXPDYRXLVXQAXKMXQQYYLLXHEPIPXXXMVQRVATVMXEYTQSGG 412 +G+ D R L+ +A Q + L +P+ + + +A + +YTQSGG Sbjct: 75 AGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGG 124 >At2g27020.1 68415.m03244 20S proteasome alpha subunit G (PAG1) (PRC8) identical to proteasome subunit alpha type 3 SP:O23715, GI:12644056 from [Arabidopsis thaliana]; identical to cDNA proteasome subunit prc8 GI:2511591 Length = 249 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 45 YSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATE 179 Y S+TTFSP G++ + + GT VGI +G+V+ E Sbjct: 8 YDLSVTTFSPDGRVFQIEYAAKAVD-NSGTVVGIKCKDGIVMGVE 51 >At5g42790.1 68418.m05212 20S proteasome alpha subunit F1 (PAF1) (gb|AAC32062.1) Length = 278 Score = 30.3 bits (65), Expect = 3.6 Identities = 16/53 (30%), Positives = 30/53 (56%) Frame = +3 Query: 42 RYSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATENKHKSIL 200 +Y +TT+SP+G+L + + G ++G+ + + VV+A NK +S L Sbjct: 5 QYDTDVTTWSPTGRLFQVEYAMEAV-KQGSAAIGLRSRSHVVLACVNKAQSEL 56 >At1g47250.1 68414.m05231 20S proteasome alpha subunit F2 (PAF2) (PRC2B) (PRS1) identical to GB:AAC32063 from [Arabidopsis thaliana] (Genetics 149 (2), 677-692 (1998)); identical to cDNA proteasome subunit prc2b GI:2511585 Length = 277 Score = 30.3 bits (65), Expect = 3.6 Identities = 16/53 (30%), Positives = 30/53 (56%) Frame = +3 Query: 42 RYSFSLTTFSPSGKLVSXPSML*GLXADGGTSVGIXASNGVVIATENKHKSIL 200 +Y +TT+SP+G+L + + G ++G+ + + VV+A NK +S L Sbjct: 5 QYDTDVTTWSPTGRLFQVEYAMEAV-KQGSAAIGLRSRSHVVLACVNKAQSEL 56 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,277,999 Number of Sequences: 28952 Number of extensions: 114319 Number of successful extensions: 197 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4163871744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -