BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_C05_e515_05.seq (1467 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 178 8e-45 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 178 bits (434), Expect = 8e-45 Identities = 85/124 (68%), Positives = 99/124 (79%) Frame = +3 Query: 66 GHSIVLMGKNTMMRKAIKDHLETNPAXEKLLPHIKGNVGFVFTXGDLVDVRDKLLENKVQ 245 G VLMGKNTM+RKAI+ HLE NP EKLLPHIKGN+GFVFT DL DVR ++ENKV Sbjct: 31 GQGEVLMGKNTMIRKAIRGHLENNPDLEKLLPHIKGNIGFVFTKEDLADVRKIIMENKVA 90 Query: 246 APARPGAIAPLFVVIPAXNTGLGPEKTSXFQALSIPTKISKGTIEIINDVHILKPXXXVG 425 APA+ G IAP+ V +PA NTGLGPEKTS FQAL+IPTKI++GTIEIINDVH++K + Sbjct: 91 APAKAGVIAPIDVFVPAGNTGLGPEKTSFFQALAIPTKIARGTIEIINDVHLIKKDEKLK 150 Query: 426 AFEA 437 AF A Sbjct: 151 AFLA 154 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,553,432 Number of Sequences: 59808 Number of extensions: 364388 Number of successful extensions: 841 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4730324131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -