BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_C04_e507_06.seq (1503 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g03120.1 68417.m00425 proline-rich family protein similar to ... 90 3e-18 At3g43230.1 68416.m04563 zinc finger (FYVE type) family protein ... 33 0.64 At2g36930.1 68415.m04529 zinc finger (C2H2 type) family protein ... 31 2.6 At2g19385.1 68415.m02261 expressed protein weak similarity to Ce... 31 2.6 At5g28480.1 68418.m03462 hypothetical protein 29 6.0 At3g56960.1 68416.m06338 phosphatidylinositol-4-phosphate 5-kina... 29 6.0 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 29 6.0 At1g45090.1 68414.m05169 Ulp1 protease family protein similar to... 29 6.0 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 90.2 bits (214), Expect = 3e-18 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +1 Query: 118 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHKDNVKFYYQKWMEEQAQHLID 270 MP+YYCDYCDTYLTHDSPSVRK H G KHK NV+ YYQ++ E+Q Q LID Sbjct: 1 MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRIYYQQFEEQQTQSLID 51 >At3g43230.1 68416.m04563 zinc finger (FYVE type) family protein contains Pfam domain PF01363: FYVE zinc finger Length = 485 Score = 32.7 bits (71), Expect = 0.64 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 420 DTSANDGSRRPHGATYDDGPSWSNAS-NDGNETTYDGPINGSYGPNGADGTDE 575 D +DGS G Y+DGP WS S E Y +G Y +G D + E Sbjct: 26 DDDDDDGSGSGSGGGYEDGPKWSVQSIPTKKEVEYPIIDSGDYVDDGYDSSGE 78 >At2g36930.1 68415.m04529 zinc finger (C2H2 type) family protein contains Prosite PS00028: Zinc finger, C2H2 type, domain; weak similarity to Zinc finger protein T86 (Swiss-Prot:O00488) [Homo sapiens] Length = 198 Score = 30.7 bits (66), Expect = 2.6 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 118 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHKDNV 219 M ++YC +CD Y + + SVR H +KHK V Sbjct: 55 MGQFYCLHCDRYFS--NVSVRDDHFKTKKHKKRV 86 >At2g19385.1 68415.m02261 expressed protein weak similarity to Cell growth regulating nucleolar protein (Swiss-Prot:Q08288) [Mus musculus] Length = 275 Score = 30.7 bits (66), Expect = 2.6 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +1 Query: 127 YYCDYCDTYLTHDSPSVRKTHCTGRKHKDNVKFYYQKWMEEQAQHL 264 ++C C+T T S H G+KH+ K ++ + +EQ+ L Sbjct: 95 WFCSLCNTKAT--SQQTLLAHADGKKHRGKAKAFHARQQQEQSTTL 138 >At5g28480.1 68418.m03462 hypothetical protein Length = 1230 Score = 29.5 bits (63), Expect = 6.0 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 426 SANDGSRRPHGATYDDGPSWSNASNDGNETTYDGPINGSYGPNGADGTD 572 S DG P G + GPS + + +G NG+ G G +G D Sbjct: 422 SGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEGGPNGAD 470 Score = 29.1 bits (62), Expect = 7.9 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = +3 Query: 426 SANDGSRRPHGATYDDGPSWSNASNDGNETTYDGPINGSYGPNGADG 566 S DG P G + GPS + N +G GPNGADG Sbjct: 431 SGGDGEGGPSGGDGEGGPSGGDGEGGPNGA------DGEGGPNGADG 471 >At3g56960.1 68416.m06338 phosphatidylinositol-4-phosphate 5-kinase family protein similar to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF02493: MORN repeat Length = 779 Score = 29.5 bits (63), Expect = 6.0 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = +3 Query: 417 HDTSANDGSRRPHGA-TYDDGPSW-SNASNDGNETTYDGPINGSYGPNGADGTDETTPYE 590 +D +DG R +G + DG + + SND E +NG+Y P+G DG+ E P + Sbjct: 215 YDGFWDDGFPRGNGTFKWADGSFYVGHWSNDPEE------MNGTYYPSGDDGSPEWDPKD 268 Query: 591 CTTN 602 TN Sbjct: 269 VFTN 272 >At2g12100.1 68415.m01300 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28270, At2g05450, At1g45090, At2g16180, At2g06750 Length = 1224 Score = 29.5 bits (63), Expect = 6.0 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 426 SANDGSRRPHGATYDDGPSWSNASNDGNETTYDGPINGSYGPNGADGTD 572 S DG P G + GPS + + +G NG+ G G +G D Sbjct: 435 SGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEGGPNGAD 483 Score = 29.1 bits (62), Expect = 7.9 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = +3 Query: 426 SANDGSRRPHGATYDDGPSWSNASNDGNETTYDGPINGSYGPNGADG 566 S DG P G + GPS + N +G GPNGADG Sbjct: 444 SGGDGEGGPSGGDGEGGPSGGDGEGGPNGA------DGEGGPNGADG 484 >At1g45090.1 68414.m05169 Ulp1 protease family protein similar to At5g28270, At2g12100, At2g05450, At2g16180, At2g06750; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1210 Score = 29.5 bits (63), Expect = 6.0 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 426 SANDGSRRPHGATYDDGPSWSNASNDGNETTYDGPINGSYGPNGADGTD 572 S DG P G + GPS + + +G NG+ G G +G D Sbjct: 426 SGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEGGPNGAD 474 Score = 29.1 bits (62), Expect = 7.9 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = +3 Query: 426 SANDGSRRPHGATYDDGPSWSNASNDGNETTYDGPINGSYGPNGADG 566 S DG P G + GPS + N +G GPNGADG Sbjct: 435 SGGDGEGGPSGGDGEGGPSGGDGEGGPNGA------DGEGGPNGADG 475 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,991,333 Number of Sequences: 28952 Number of extensions: 469495 Number of successful extensions: 992 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4009654272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -