SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030725E6_C03_e499_05.seq
         (1551 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    33   0.006

>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 33.1 bits (72), Expect = 0.006
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
 Frame = +2

Query: 143  VYIVSKSGGLIYNYDHNIPKVETE---KTFGYPLDIKLHHENKKIVVSFGQRDGI 298
            V +  + GG++  +  N+PK ETE   K+  +     LHH   K++ SF +  G+
Sbjct: 1270 VVVNQQIGGIVTYFSTNLPKRETEVRKKSLDFGKLCSLHHHLSKLIKSFNEIYGV 1324


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 294,489
Number of Sequences: 336
Number of extensions: 5910
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 60
effective length of database: 102,425
effective search space used: 46705800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -