BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_C03_e499_05.seq (1551 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 5.9 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 7.8 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.0 bits (52), Expect = 5.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 1164 GTPXLPXXXXIPXQXXPXXWGXPXPSL*TGPXGEPXG 1274 G P LP P P G P L GP G P G Sbjct: 572 GFPNLPNAQPPPAPPPPPPMGPPPSPLAGGPLGGPAG 608 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 7.8 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -3 Query: 718 QLASYRHLERVERALEGVVRVQLIDPLQDYLCTLHVRIRHYYKLYTC 578 Q +Y L + L +V L L +YL +++ R+ + K+Y C Sbjct: 104 QRDNYERLVHQLQDLAALVLQDLPTELGEYLISVNRRVDRFSKIYCC 150 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,290,831 Number of Sequences: 2352 Number of extensions: 23770 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 182471355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -