BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_C01_e483_05.seq (1486 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 26 2.4 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 25 7.4 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 26.2 bits (55), Expect = 2.4 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = -2 Query: 450 PGNHGKLHRLSVAYRTHSLARVVSD--YRSLMYKHIFFGVIPIDETISTLDVEP 295 PG+HG H + A T + + YR+ +H+ G IDE + + V P Sbjct: 392 PGSHGSFHEIGRAMATLMSDEIFHEVAYRAKRREHLLAG---IDEFLDAVTVLP 442 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 24.6 bits (51), Expect = 7.4 Identities = 9/23 (39%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -2 Query: 651 PLCTPLIGWRSTAPDTTS--AWG 589 P+ L+GWR +PD ++ WG Sbjct: 7 PIVKRLLGWRKVSPDDSAEGKWG 29 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 870,216 Number of Sequences: 2352 Number of extensions: 14209 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 173530665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -