BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_B12_e570_04.seq (1556 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 25 1.8 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 7.1 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 258 FFPHSNASRHHNVRVSFIYIAFSCIGR 178 F P A+RH+ V F SC+GR Sbjct: 465 FLPEKTANRHYYAFVPFSAGPRSCVGR 491 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/71 (19%), Positives = 34/71 (47%) Frame = -3 Query: 474 LLATVPVKFVAL*ITFKLSEINLKILRI*SLKSSPISNYLCLLSCVY*NNFVIVILGQFI 295 ++ + + F+ + + + S+ K+ S+ S +L L + + V+ +LG+F+ Sbjct: 248 IIPCMGISFLTVLVFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFV 307 Query: 294 SVRVTSDVFSL 262 + D FS+ Sbjct: 308 LFTMILDTFSI 318 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 313,164 Number of Sequences: 438 Number of extensions: 5673 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 54668625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -