BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_B08_e538_04.seq (1538 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81037-5|CAB02752.1| 320|Caenorhabditis elegans Hypothetical pr... 36 0.10 Z81550-4|CAB04477.1| 317|Caenorhabditis elegans Hypothetical pr... 35 0.13 >Z81037-5|CAB02752.1| 320|Caenorhabditis elegans Hypothetical protein C17E4.9 protein. Length = 320 Score = 35.5 bits (78), Expect = 0.10 Identities = 15/31 (48%), Positives = 23/31 (74%) Frame = +2 Query: 122 LINIECKAWAKNIFYDRYERRGSVHFELMVD 214 L+ +EC+A+A NI +D R G V+FE+MV+ Sbjct: 280 LVIVECRAYALNIEHDISSRLGMVYFEVMVE 310 >Z81550-4|CAB04477.1| 317|Caenorhabditis elegans Hypothetical protein F55F3.3 protein. Length = 317 Score = 35.1 bits (77), Expect = 0.13 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +2 Query: 122 LINIECKAWAKNIFYDRYERRGSVHFELMVD 214 L+ +EC+A+A NI +D R G V+FEL V+ Sbjct: 277 LVIVECRAYASNIEHDISTRLGMVYFELFVE 307 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,008,357 Number of Sequences: 27780 Number of extensions: 419030 Number of successful extensions: 870 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 870 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4431789446 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -