BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_B08_e538_04.seq (1538 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 25 2.3 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 7.0 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 7.0 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 7.0 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 7.0 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 7.0 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 7.0 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 7.0 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 7.0 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 7.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 7.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 7.0 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 23 9.3 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +1 Query: 214 PRLSTNRTSPLTTQFTNFQQNYSTYNK 294 P++ +N +PL+ + N+ NY+ YNK Sbjct: 79 PKIISNN-NPLSNNY-NYNNNYNNYNK 103 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 214 PRLSTNRTSPLTTQFTNFQQNYSTYNK 294 P++ +N S L+ + N+ NY+ YNK Sbjct: 79 PKIISNNNS-LSNNY-NYNNNYNNYNK 103 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 214 PRLSTNRTSPLTTQFTNFQQNYSTYNK 294 P++ +N S L+ + N+ NY+ YNK Sbjct: 79 PKIISNNNS-LSNNY-NYNNNYNNYNK 103 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 214 PRLSTNRTSPLTTQFTNFQQNYSTYNK 294 P++ +N S L+ + N+ NY+ YNK Sbjct: 79 PKIISNNNS-LSNNY-NYNNNYNNYNK 103 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 214 PRLSTNRTSPLTTQFTNFQQNYSTYNK 294 P++ +N S L+ + N+ NY+ YNK Sbjct: 79 PKIISNNNS-LSNNY-NYNNNYNNYNK 103 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 214 PRLSTNRTSPLTTQFTNFQQNYSTYNK 294 P++ +N S L+ + N+ NY+ YNK Sbjct: 79 PKIISNNNS-LSNNY-NYNNNYNNYNK 103 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 214 PRLSTNRTSPLTTQFTNFQQNYSTYNK 294 P++ +N S L+ + N+ NY+ YNK Sbjct: 79 PKIISNNNS-LSNNY-NYNNNYNNYNK 103 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 214 PRLSTNRTSPLTTQFTNFQQNYSTYNK 294 P++ +N S L+ + N+ NY+ YNK Sbjct: 79 PKIISNNNS-LSNNY-NYNNNYNNYNK 103 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 214 PRLSTNRTSPLTTQFTNFQQNYSTYNK 294 P++ +N S L+ + N+ NY+ YNK Sbjct: 79 PKIISNNNS-LSNNY-NYNNNYNNYNK 103 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.0 bits (47), Expect = 7.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -1 Query: 497 SHKTQIVQHNSLHSHN 450 SHKTQ + ++++ SHN Sbjct: 256 SHKTQNLYYSAMSSHN 271 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 214 PRLSTNRTSPLTTQFTNFQQNYSTYNK 294 P++ +N S L+ + N+ NY+ YNK Sbjct: 312 PKIISNNNS-LSNNY-NYNNNYNNYNK 336 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 214 PRLSTNRTSPLTTQFTNFQQNYSTYNK 294 P++ +N S L+ + N+ NY+ YNK Sbjct: 312 PKIISNNNS-LSNNY-NYNNNYNNYNK 336 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 22.6 bits (46), Expect = 9.3 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = -1 Query: 410 KTSMYNTHNNQHS*TRNKSNIIIIKTYSVP---YC 315 K S YN +NN + K+ II I+ VP YC Sbjct: 90 KYSNYNNYNNYNKKLYYKNYIINIEQIPVPVPIYC 124 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 292,856 Number of Sequences: 438 Number of extensions: 5720 Number of successful extensions: 21 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 53950875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -