Samia BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030725E6_B07_e530_03.seq
         (1516 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6LF21 Cluster: Putative DNA polymerase i; n=1; Plasmod...    36   3.7  

>UniRef50_Q6LF21 Cluster: Putative DNA polymerase i; n=1; Plasmodium
            falciparum 3D7|Rep: Putative DNA polymerase i -
            Plasmodium falciparum (isolate 3D7)
          Length = 1444

 Score = 35.5 bits (78), Expect = 3.7
 Identities = 15/47 (31%), Positives = 22/47 (46%)
 Frame = -1

Query: 445  HDNNNNNKTLFHFDLKANTTSTRYITSRIVKHNYKYTQLDMNVLITY 305
            HDNNNNN  +    +  N  ST  +   I+   Y    ++   LIT+
Sbjct: 1087 HDNNNNNNNIPQIHISTNNVSTNNVPMNIMSSTYPLYTMNKKNLITF 1133


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 951,761,825
Number of Sequences: 1657284
Number of extensions: 14743829
Number of successful extensions: 31676
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 27834
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31368
length of database: 575,637,011
effective HSP length: 104
effective length of database: 403,279,475
effective search space used: 161311790000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)