BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_B04_e506_04.seq (1545 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 4.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 4.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 4.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 4.6 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 6.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 8.0 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 263 CICFYPGQRGVCEHSSQ 213 CICF PG G+ S++ Sbjct: 203 CICFVPGVLGLLSRSNK 219 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 263 CICFYPGQRGVCEHSSQ 213 CICF PG G+ S++ Sbjct: 203 CICFVPGVLGLLSRSNK 219 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 263 CICFYPGQRGVCEHSSQ 213 CICF PG G+ S++ Sbjct: 203 CICFVPGVLGLLSRSNK 219 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 263 CICFYPGQRGVCEHSSQ 213 CICF PG G+ S++ Sbjct: 203 CICFVPGVLGLLSRSNK 219 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 6.0 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +2 Query: 179 QVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQV 322 + +FK + +A+K +VV+DK K + + + + + D C + Sbjct: 198 KTRFKTINNILENLWAKKLIVVKDKKKSRSDEQTIDICMRCHDQLCDM 245 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 8.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 441 CWQEDCCRGSA 473 CWQ DC +G A Sbjct: 1949 CWQVDCNKGPA 1959 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 280,346 Number of Sequences: 336 Number of extensions: 5470 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 46500950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -