BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_B03_e498_03.seq (1616 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCPB16A4.03c |ade10||IMP cyclohydrolase|Schizosaccharomyces pom... 165 1e-41 >SPCPB16A4.03c |ade10||IMP cyclohydrolase|Schizosaccharomyces pombe|chr 3|||Manual Length = 585 Score = 165 bits (402), Expect = 1e-41 Identities = 77/135 (57%), Positives = 93/135 (68%) Frame = +3 Query: 66 GIVAPGYTPEALNILRKKKGGNYCVLQMDPSYEPDLTERKTLYGLSLEQRRNDAKITAGL 245 G++APGY PEAL +L+KKKGG YCVLQMDP Y P E + +YG+SL+Q RN AKI L Sbjct: 332 GVIAPGYEPEALELLKKKKGGKYCVLQMDPKYVPAEIETRQVYGISLQQHRNHAKIDFSL 391 Query: 246 FGNIVTAKKELPEEAVRDLIVATIALKYTQSNSVCYARXXXXXXXXXXXXSRIHCTRLAG 425 F +V+ K+LP+ A+ DL++AT ALKYTQSNSVCYA+ SRIHC RLAG Sbjct: 392 FEKVVSKNKDLPKSALIDLVIATTALKYTQSNSVCYAKNGMVVGLGAGQQSRIHCNRLAG 451 Query: 426 GKAVLWRXRSHPAVL 470 KA W R HP VL Sbjct: 452 DKADNWWLRHHPKVL 466 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,252,290 Number of Sequences: 5004 Number of extensions: 35676 Number of successful extensions: 94 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 915764388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -