Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030725E6_B02_e490_04.seq
         (1555 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g15520.1 68414.m01867 ABC transporter family protein similar ...    29   6.3  

>At1g15520.1 68414.m01867 ABC transporter family protein similar to
           ABC1 protein GI:14331118 from [Nicotiana
           plumbaginifolia]
          Length = 1423

 Score = 29.5 bits (63), Expect = 6.3
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +3

Query: 288 LESKGSPRSARALEPLSDEPKAREAXVESRLVDSAADFLENYVIQFKMPSSAVEGIRRSL 467
           L S G P++  A EP SDE + + A  E  +V++ A+     V+ F+  S   + +  S+
Sbjct: 776 LNSLGKPQAVIAEEPASDETELQSARSEG-VVEAGANKKRGMVLPFEPHSITFDNVVYSV 834

Query: 468 E 470
           +
Sbjct: 835 D 835


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,258,014
Number of Sequences: 28952
Number of extensions: 258234
Number of successful extensions: 618
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 607
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 618
length of database: 12,070,560
effective HSP length: 84
effective length of database: 9,638,592
effective search space used: 4173510336
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)