BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_B01_e482_03.seq (1436 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44648| Best HMM Match : UPF0005 (HMM E-Value=0.00022) 90 5e-18 SB_34537| Best HMM Match : UPF0005 (HMM E-Value=6.5e-05) 53 6e-07 >SB_44648| Best HMM Match : UPF0005 (HMM E-Value=0.00022) Length = 192 Score = 89.8 bits (213), Expect = 5e-18 Identities = 41/68 (60%), Positives = 50/68 (73%) Frame = +2 Query: 95 NKIATLIYASLGALIFSIYLVYDTQLMMGGKHKYSISPEEYIFAALNLYLDXXXXXXXXX 274 N++ ++YASLGAL+F++YLVYDTQ+MMGG YSISPEEYIFAALNLYLD Sbjct: 125 NRVVQIVYASLGALLFALYLVYDTQIMMGGGKMYSISPEEYIFAALNLYLDIVNMFLYIL 184 Query: 275 XXXGASRN 298 A+RN Sbjct: 185 QLISAARN 192 >SB_34537| Best HMM Match : UPF0005 (HMM E-Value=6.5e-05) Length = 179 Score = 52.8 bits (121), Expect = 6e-07 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +2 Query: 101 IATLIYASLGALIFSIYLVYDTQLMMGGKHKYSISPEEYIFAALNLYLD 247 I L YA LGAL+FS ++V+DT ++M +SPEEYI A++NLY+D Sbjct: 118 ILELAYAVLGALLFSAFIVFDTHMLMN-----KMSPEEYILASINLYMD 161 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,473,465 Number of Sequences: 59808 Number of extensions: 488789 Number of successful extensions: 962 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4612946361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -