BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_A11_e561_01.seq (1470 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 25 5.5 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 24 9.7 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.0 bits (52), Expect = 5.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -3 Query: 1132 GAXXXPPPXXPPXXGXPPGGV 1070 G PPP PP PGGV Sbjct: 779 GIGSPPPPPPPPPSSLSPGGV 799 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 24.2 bits (50), Expect = 9.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 467 VAKLLGNNFTEINAQSVDDLLGQVRVRASAEDL 369 V K L FT+ + +DD++ ++ RA A+DL Sbjct: 1020 VRKSLDYIFTKRELKILDDIMPEMTKRARADDL 1052 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,239,126 Number of Sequences: 2352 Number of extensions: 25863 Number of successful extensions: 42 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 171498690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -