BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_A07_e529_01.seq (1524 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 27 1.4 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 25 4.4 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 27.1 bits (57), Expect = 1.4 Identities = 15/48 (31%), Positives = 20/48 (41%) Frame = +1 Query: 343 VLGCGLRGHVEGSRASRVPRARPQPRCLELQLEAAPEDTRQRLCETSH 486 VL C GH G+ + RP C E+T+Q + E SH Sbjct: 71 VLTCYCEGHCPGNLQNGTCETRPGGSCFVSVEAVLDEETKQLVPEYSH 118 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 25.4 bits (53), Expect = 4.4 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +1 Query: 55 GCRXFGTRAHLSMETSK-EVGEAIKTKIQEGVV*KGRFIHNFEAL 186 GC FG HL+ T K +VG +K+ + I FE L Sbjct: 377 GCTIFGILGHLAHVTGKTDVGNVVKSDAGLAFISYPEAIAKFEVL 421 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,082,417 Number of Sequences: 2352 Number of extensions: 18553 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 178813800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -