BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_A07_e529_01.seq (1524 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 25 1.7 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 5.3 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 25.0 bits (52), Expect = 1.7 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -1 Query: 840 TRRPIXVDAXLSERHPVATV 781 T+RP+ ++ L +RHP+ T+ Sbjct: 131 TKRPLPNESQLIKRHPIVTI 150 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.4 bits (48), Expect = 5.3 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = -3 Query: 496 DLVSDWFHRGVVEYPLELLRVEVRDTEAADEPVAH 392 ++++ W +RGV + ++ + D DEP A+ Sbjct: 207 NVLTFWMNRGVDGFRIDAINHMFEDARLLDEPSAN 241 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 298,767 Number of Sequences: 438 Number of extensions: 5472 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 53352750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -