BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_A06_e521_02.seq (1525 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 24 3.4 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 23 7.9 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 23.8 bits (49), Expect = 3.4 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = -3 Query: 227 IFSPSVFLFSKECSS-------LYWNFIFVFFYAII*QRNYCLAR 114 +FS S F EC + L + F+ VFF+ II NY R Sbjct: 75 LFSRSDFFQQFECDNEPKLRHYLIFIFVNVFFWVIILMSNYAFTR 119 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 22.6 bits (46), Expect = 7.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 114 TQSTATCFLFLPSCRIXCS 58 T T L LP+CR+ CS Sbjct: 40 TPDTEATGLSLPACRLFCS 58 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 282,948 Number of Sequences: 336 Number of extensions: 5717 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45783975 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -