BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_A04_e505_02.seq (1418 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 5.5 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 22 9.6 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.0 bits (47), Expect = 5.5 Identities = 12/59 (20%), Positives = 32/59 (54%) Frame = +1 Query: 475 WLKI*TSRKKIDLCDTWRQLPIKKGIVVCYILVLIFTSSI*LYIM*L*WHFIWYILVIV 651 W+++ +++ LC ++ I + I+V +++++ T + + I + F+ IL +V Sbjct: 716 WVEVWERKRRQYLCPVLLRVSILRNIIVGTLMMVLGTGCVRIKITGVWLKFLRVILSVV 774 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 22.2 bits (45), Expect = 9.6 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 572 SLFLLLVFDFILCNCDGILFGTFWLLYLKGY*K 670 SL L ++ I+ C I+ T W KG+ K Sbjct: 190 SLSLFIIPASIIATCYAIIIITIWSKNAKGFIK 222 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 243,976 Number of Sequences: 336 Number of extensions: 4800 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 42199100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -