BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_A02_e489_02.seq (1427 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 23 4.2 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 7.3 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 7.3 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 7.3 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 7.3 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 7.3 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 7.3 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 7.3 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 7.3 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 9.7 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 23.4 bits (48), Expect = 4.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 840 LLTYNIYKXEYWS 878 +L YN +K +YWS Sbjct: 69 ILAYNFWKKKYWS 81 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 7.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 568 LSSHPASNCVRPSGLSLSRNHLMYGPGSPCSAVKHNDVSS 449 LS+ SN + SGL+ + PG P ++ ++SS Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSS 168 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 7.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 568 LSSHPASNCVRPSGLSLSRNHLMYGPGSPCSAVKHNDVSS 449 LS+ SN + SGL+ + PG P ++ ++SS Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSS 168 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 7.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 568 LSSHPASNCVRPSGLSLSRNHLMYGPGSPCSAVKHNDVSS 449 LS+ SN + SGL+ + PG P ++ ++SS Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSS 168 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 7.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 568 LSSHPASNCVRPSGLSLSRNHLMYGPGSPCSAVKHNDVSS 449 LS+ SN + SGL+ + PG P ++ ++SS Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSS 168 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 7.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 568 LSSHPASNCVRPSGLSLSRNHLMYGPGSPCSAVKHNDVSS 449 LS+ SN + SGL+ + PG P ++ ++SS Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSS 168 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 7.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 568 LSSHPASNCVRPSGLSLSRNHLMYGPGSPCSAVKHNDVSS 449 LS+ SN + SGL+ + PG P ++ ++SS Sbjct: 85 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSS 124 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 7.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 568 LSSHPASNCVRPSGLSLSRNHLMYGPGSPCSAVKHNDVSS 449 LS+ SN + SGL+ + PG P ++ ++SS Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSS 168 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 7.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 568 LSSHPASNCVRPSGLSLSRNHLMYGPGSPCSAVKHNDVSS 449 LS+ SN + SGL+ + PG P ++ ++SS Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSS 168 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.2 bits (45), Expect = 9.7 Identities = 14/58 (24%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +3 Query: 495 PYIKWFLDKL-KPEGLTQLLAGWEDKSAEAVCTFAFCAGNCENLDVILFQGKTRGKIV 665 P I +L+K KP L W D +++ F F A N + ++ T+ ++ Sbjct: 390 PEIITYLEKNGKPRTTDTFLDLWSDYQNKSLAAFDFVARNSDTPIILWTSHLTQADVI 447 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 272,149 Number of Sequences: 336 Number of extensions: 5460 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 42506375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -