BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_H12_e384_16.seq (1495 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016674-5|AAB66127.3| 339|Caenorhabditis elegans Hypothetical ... 30 3.7 >AF016674-5|AAB66127.3| 339|Caenorhabditis elegans Hypothetical protein C03H5.2 protein. Length = 339 Score = 30.3 bits (65), Expect = 3.7 Identities = 19/62 (30%), Positives = 32/62 (51%) Frame = +2 Query: 695 LVSKTVYRYIFISYILLKALFILVXFKSDCLGGVVVLRXHXRYEISDSILGSGQVILGFF 874 ++ K+++RY +++ ILL A LV + S ++ SD+ILG G V+ F Sbjct: 140 MLGKSLHRYNWMALILLTAGVALVQYPSG--DSTTSKSTAAEHDASDNILGLGAVLAACF 197 Query: 875 YS 880 S Sbjct: 198 SS 199 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,454,831 Number of Sequences: 27780 Number of extensions: 443858 Number of successful extensions: 1191 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1171 length of database: 12,740,198 effective HSP length: 84 effective length of database: 10,406,678 effective search space used: 4297958014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -