BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_H07_e344_15.seq (1463 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 6.6 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 6.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 6.6 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 23.0 bits (47), Expect = 6.6 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = -1 Query: 560 VWRPDCDL*LWQNCQRREPVVLDHPSFLPNYTQLYLQA*HPQAL--HCQLLELLSCHSK 390 +WRPDC ++N ++ V H +PN+ YL H + L +L +LSC K Sbjct: 87 IWRPDC---FFKNAKK----VTFHEMSIPNH---YLWLYHDKTLLYMSKLTLVLSCAMK 135 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.0 bits (47), Expect = 6.6 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -2 Query: 112 LGQDGRFRKNTYAXCRIXCSPGDXTSX*SG 23 LG +F N Y I C+ TS SG Sbjct: 301 LGSYNKFNNNVYKDALIVCTVNSCTSMLSG 330 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.0 bits (47), Expect = 6.6 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -2 Query: 112 LGQDGRFRKNTYAXCRIXCSPGDXTSX*SG 23 LG +F N Y I C+ TS SG Sbjct: 354 LGSYNKFNNNVYKDALIVCTVNSCTSMLSG 383 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 322,694 Number of Sequences: 438 Number of extensions: 7080 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 50960250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -