BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_H06_e336_16.seq (1494 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.1 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -2 Query: 137 YIQNKIIKKTLIIRIVKMNHLVPNXLQPGGXH*XLERPPPRGSXS 3 + + +I ++ I+++ H++ N PG LERPPPR S + Sbjct: 3 HFTDTLISANIVFNILEVIHVLSNSCSPGDPL-VLERPPPRWSSN 46 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 30.3 bits (65), Expect = 4.1 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = -2 Query: 140 NYIQNKIIKKTLIIRI--VKMNHLVPNXLQPGGXH*XLERPPPRGSXS 3 NYI NKII + ++ + V N PG LERPPPR S + Sbjct: 160 NYINNKIICVAINLQFSWIDWTRRVSNSCSPGDPL-VLERPPPRWSSN 206 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,763,895 Number of Sequences: 59808 Number of extensions: 515846 Number of successful extensions: 2225 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2208 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4835964124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -