SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030723E4_H05_e328_15.seq
         (1464 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2 ...    23   5.7  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    23   5.7  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   9.9  

>AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2
           protein protein.
          Length = 301

 Score = 23.0 bits (47), Expect = 5.7
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -1

Query: 201 HL*ESPNYAGQRLHV 157
           HL +SPNY   +LHV
Sbjct: 181 HLRDSPNYIKPQLHV 195


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 23.0 bits (47), Expect = 5.7
 Identities = 17/56 (30%), Positives = 22/56 (39%)
 Frame = +3

Query: 9   PAVAAALXTSGIPRAAGNSARGRPAYDNRGKREFDRRSGSDKTGVKPIDKREGAGP 176
           PAV AA   +    AA     G P +D+R      RR  + +        R G GP
Sbjct: 279 PAVRAAGDAAAARGAARADGAGGPLHDHRPALAQQRRVAAVQVPQLAGGGRRGPGP 334


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 22.2 bits (45), Expect = 9.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 66  ARGRPAYDNRGK 101
           ARGR  YD+RG+
Sbjct: 149 ARGRSLYDSRGR 160


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 211,475
Number of Sequences: 336
Number of extensions: 3924
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 60
effective length of database: 102,425
effective search space used: 43735475
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -