BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_H04_e320_16.seq (1544 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15747| Best HMM Match : Ribosomal_L17 (HMM E-Value=2.5) 32 1.4 SB_5023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 10.0 >SB_15747| Best HMM Match : Ribosomal_L17 (HMM E-Value=2.5) Length = 167 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/59 (28%), Positives = 26/59 (44%) Frame = -2 Query: 436 HTTLQQNGGYIFITKKHAVICFFCYKFII*QLYSSENEFTLSLPTLVINHLLLTDNQIH 260 HT GY IT V F + ++ YS + +T PT + H LL +++H Sbjct: 92 HTHYSDKTGYTRITPTRRVTHAFSRQDVLHTHYSDKTGYTRITPTRQVTHALLRQDRLH 150 >SB_5023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 29.1 bits (62), Expect = 10.0 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -3 Query: 228 HEYSYT-HTYANYCHFNSEMYTFAQYHFVTDTILTLPSLKYVTNNKYADFYLV 73 H SY + ++Y H M ++AQY+ +D L Y N +D++L+ Sbjct: 218 HMTSYAQYNSSSYYHLMYHMTSYAQYNSSSDYYLMYHMTSYAQYNSSSDYHLM 270 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,031,022 Number of Sequences: 59808 Number of extensions: 598638 Number of successful extensions: 2461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2455 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5035506333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -