Samia BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030723E4_H04_e320_16.seq
         (1544 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK127601-1|BAC87052.1|  415|Homo sapiens protein ( Homo sapiens ...    33   2.8  

>AK127601-1|BAC87052.1|  415|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45698 fis, clone FEBRA2017811. ).
          Length = 415

 Score = 33.1 bits (72), Expect = 2.8
 Identities = 14/44 (31%), Positives = 26/44 (59%)
 Frame = -3

Query: 240 HSCPHEYSYTHTYANYCHFNSEMYTFAQYHFVTDTILTLPSLKY 109
           H+  H ++YTH +A + H N+ M+T+   H  T T + + +L +
Sbjct: 302 HTHTHTHTYTHAHA-HIHINTYMHTYTYTHIRTYTHIQMHTLTW 344


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 155,614,679
Number of Sequences: 237096
Number of extensions: 2972766
Number of successful extensions: 7282
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7071
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7277
length of database: 76,859,062
effective HSP length: 93
effective length of database: 54,809,134
effective search space used: 23074645414
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)