BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_H04_e320_16.seq (1544 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64853-2|AAB04975.2| 529|Caenorhabditis elegans Hypothetical pr... 29 8.8 >U64853-2|AAB04975.2| 529|Caenorhabditis elegans Hypothetical protein K11G9.2 protein. Length = 529 Score = 29.1 bits (62), Expect = 8.8 Identities = 22/81 (27%), Positives = 33/81 (40%), Gaps = 3/81 (3%) Frame = +3 Query: 444 EQYYKNISK*RWRIFTIGNKQNEIVEISNVQ*NLKDHKELKKKYAYISVSH*QKG*NFK- 620 E+ +K + +R + N +N I N N D E +K YI S G Sbjct: 334 EENFKRRVESEYRGDVVENPENVQKNIMNFYTNYCDESEERKLVDYIGHSVYNAGVLLSA 393 Query: 621 --LYKKKQIMYFCIMXYWNPD 677 L + +YF + +WNPD Sbjct: 394 ESLARAGNCVYFYVFDFWNPD 414 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,778,422 Number of Sequences: 27780 Number of extensions: 494835 Number of successful extensions: 871 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 870 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4452547242 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -