BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_H02_e304_16.seq (1512 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1620 + 38697960-38698131,38698532-38700732 32 1.0 02_05_0390 + 28557722-28557937,28558440-28558514,28558597-285587... 29 9.6 01_01_0513 + 3736893-3737047,3737298-3737340,3737631-3737765,373... 29 9.6 >01_06_1620 + 38697960-38698131,38698532-38700732 Length = 790 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 50 PRAAGNSARGYIGIWYDK 103 P A G+S+R YIGIWY+K Sbjct: 56 PAAGGSSSRWYIGIWYNK 73 >02_05_0390 + 28557722-28557937,28558440-28558514,28558597-28558766, 28559046-28559124,28559320-28559516,28560300-28560387, 28560453-28560679,28560763-28560919,28561467-28561517 Length = 419 Score = 29.1 bits (62), Expect = 9.6 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -2 Query: 212 QSVRAYNEHCLGMSKIIYGCHASYFIQTPQ 123 Q+++ Y EH G + +++G HA Y I+ PQ Sbjct: 342 QAIKGY-EHFWGGNCVLFGTHAHYQIRNPQ 370 >01_01_0513 + 3736893-3737047,3737298-3737340,3737631-3737765, 3737879-3738010,3738129-3738278,3738353-3738373, 3738468-3738675,3738796-3738877,3738983-3739088, 3739245-3739358,3739458-3739685 Length = 457 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 742 ISVMSSS*ESQKCMILVNSIFYCN-IVIQNINLKWTNKT 629 I++ +S E + IL + +C I + NINL W N T Sbjct: 394 INIRGTSSEQEAIKILCSQSVHCQGIYLSNINLSWENHT 432 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,751,261 Number of Sequences: 37544 Number of extensions: 443553 Number of successful extensions: 611 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4849681144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -