BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_G11_e375_13.seq (1582 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0202 - 23211342-23211385,23211493-23211579,23211666-232117... 29 7.7 >05_05_0202 - 23211342-23211385,23211493-23211579,23211666-23211779, 23211886-23212111,23212222-23212401,23212511-23212654, 23212818-23212979,23213093-23213296,23214109-23214156, 23214601-23214846 Length = 484 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -2 Query: 714 PESGXFGFSGKRAASGLDEIFPFSEFISIRGFISTADIGI 595 P G FG G++ A + EI F + GFIS A G+ Sbjct: 231 PYRGAFGSDGEKYARDVQEIIDFGTTGRVGGFISEAIQGV 270 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,272,347 Number of Sequences: 37544 Number of extensions: 250922 Number of successful extensions: 620 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5116529628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -