BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_G11_e375_13.seq (1582 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 45 2e-04 SB_6444| Best HMM Match : CRAM_rpt (HMM E-Value=3e-11) 30 5.9 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 44.8 bits (101), Expect = 2e-04 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +2 Query: 140 MTILLRMDDKMNRQLTCPVTRADTAAALAHELVQLGFIHEADR 268 +T+ L++DDKMNRQLTC V + LA EL+ GF + R Sbjct: 306 LTVTLKLDDKMNRQLTCDVKIGENPLELADELILYGFANRNGR 348 >SB_6444| Best HMM Match : CRAM_rpt (HMM E-Value=3e-11) Length = 2297 Score = 29.9 bits (64), Expect = 5.9 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -2 Query: 690 SGKRAASGLDEIFPFSEFISIRGFISTADIGI 595 + K + LD FP +E +++GF++T D+GI Sbjct: 1052 ASKSKSYKLDHGFPETEDATVKGFVNTPDVGI 1083 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,852,418 Number of Sequences: 59808 Number of extensions: 296564 Number of successful extensions: 743 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5176359657 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -