BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_G11_e375_13.seq (1582 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75545-6|CAA99888.3| 649|Caenorhabditis elegans Hypothetical pr... 37 0.034 AL008986-2|CAA15621.3| 649|Caenorhabditis elegans Hypothetical ... 37 0.034 >Z75545-6|CAA99888.3| 649|Caenorhabditis elegans Hypothetical protein H37N21.1 protein. Length = 649 Score = 37.1 bits (82), Expect = 0.034 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +2 Query: 140 MTILLRMDDKMNRQLTCPVTRADTAAALAHELVQLGFIHEADRDKI 277 M+I+L ++D+M+RQLT + + D L L+ GF+ + D + + Sbjct: 535 MSIVLLLEDQMHRQLTTSINKGDNPETLTENLITHGFMCQLDSEGV 580 >AL008986-2|CAA15621.3| 649|Caenorhabditis elegans Hypothetical protein H37N21.1 protein. Length = 649 Score = 37.1 bits (82), Expect = 0.034 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +2 Query: 140 MTILLRMDDKMNRQLTCPVTRADTAAALAHELVQLGFIHEADRDKI 277 M+I+L ++D+M+RQLT + + D L L+ GF+ + D + + Sbjct: 535 MSIVLLLEDQMHRQLTTSINKGDNPETLTENLITHGFMCQLDSEGV 580 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,774,712 Number of Sequences: 27780 Number of extensions: 232496 Number of successful extensions: 500 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 499 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4577094018 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -