BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_G08_e351_14.seq (1424 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT015181-1|AAT94410.1| 76|Drosophila melanogaster SD11559p pro... 31 2.9 AE014298-1849|AAN09647.1| 137|Drosophila melanogaster CG32638-P... 31 2.9 >BT015181-1|AAT94410.1| 76|Drosophila melanogaster SD11559p protein. Length = 76 Score = 31.5 bits (68), Expect = 2.9 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 697 FVYFFSWLPSIWFXSWLHHSFEFYN-LILFLISWS 798 FV+FF ++ + SW H ++EFYN L L + WS Sbjct: 20 FVHFF-FISNAMLGSWGHGAYEFYNFLFLIAMFWS 53 >AE014298-1849|AAN09647.1| 137|Drosophila melanogaster CG32638-PA protein. Length = 137 Score = 31.5 bits (68), Expect = 2.9 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 697 FVYFFSWLPSIWFXSWLHHSFEFYN-LILFLISWS 798 FV+FF ++ + SW H ++EFYN L L + WS Sbjct: 20 FVHFF-FISNAMLGSWGHGAYEFYNFLFLIAMFWS 53 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,386,988 Number of Sequences: 53049 Number of extensions: 723527 Number of successful extensions: 1156 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1156 length of database: 24,988,368 effective HSP length: 88 effective length of database: 20,320,056 effective search space used: 7843541616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -