BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_G06_e335_14.seq (1525 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 24 3.4 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 4.5 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.8 bits (49), Expect = 3.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 629 PLSPAGVIAKRPAPIALPNSCA 694 P P GV KR P AL +CA Sbjct: 52 PCPPQGVDLKRVLPEALQTNCA 73 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 23.4 bits (48), Expect = 4.5 Identities = 13/60 (21%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = -1 Query: 253 NLAFPCLSVFKVCL*PKQYLPDFITRARRELIDSMVFFCF----FAATIMIAVFYSDPHR 86 +LA+ + ++ +C+ ++ + DF+ R E + + F + + T MI + Y + +R Sbjct: 124 HLAYGVVIIYSICVQTEKSVFDFLCRHTVEYFQNYIHFFYQLLLYLITDMILMRYKELNR 183 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 272,927 Number of Sequences: 336 Number of extensions: 5439 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45783975 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -