Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030723E4_G04_e319_14.seq
         (1562 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY600513-1|AAT11861.1|  314|Tribolium castaneum spalt-like prote...    25   2.0  

>AY600513-1|AAT11861.1|  314|Tribolium castaneum spalt-like protein
           protein.
          Length = 314

 Score = 24.6 bits (51), Expect = 2.0
 Identities = 14/47 (29%), Positives = 21/47 (44%)
 Frame = +3

Query: 783 LETRTENVESRSSDQSQQVCCMYEAVARSTTRRCYPGADVGSVPXKC 923
           L+   +N+E + SD +Q V C      +S  +  Y     G  P KC
Sbjct: 120 LQQLVDNIEHKLSDPNQCVICHRVLSCKSALQMHY-RTHTGERPFKC 165


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 266,148
Number of Sequences: 336
Number of extensions: 5335
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 60
effective length of database: 102,425
effective search space used: 47115500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)