Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030723E4_G02_e303_14.seq
         (1491 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.           24   9.8  

>CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.
          Length = 1664

 Score = 24.2 bits (50), Expect = 9.8
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 3/61 (4%)
 Frame = -3

Query: 472 QVPLSTAI*VKIMTWSCK--LSPTGKSWTTSIPKESKWS-LGPIPDKNNNFAVLKVPADI 302
           QVPL + + +  M WSC+      G+     +   SK S +  +  +N    +LK   DI
Sbjct: 185 QVPLGSDVGITAMAWSCEKFKMEEGEDTEPGVTNASKRSFVLAVSFQNGYIYLLKSYDDI 244

Query: 301 T 299
           T
Sbjct: 245 T 245


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 894,732
Number of Sequences: 2352
Number of extensions: 17248
Number of successful extensions: 38
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 38
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38
length of database: 563,979
effective HSP length: 67
effective length of database: 406,395
effective search space used: 174343455
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)