Samia BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030723E4_F08_e350_12.seq
         (1524 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L09634-3|AAA27965.1|  168|Caenorhabditis elegans Hypothetical pr...    31   2.8  

>L09634-3|AAA27965.1|  168|Caenorhabditis elegans Hypothetical
           protein C30C11.1 protein.
          Length = 168

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = -2

Query: 572 TVYDVLIEFMIDIFIPKVSVTSCPKSVRRRFTWT-LVKPFGHTQSSPALS 426
           +V +++ +F I   +PK   TS PK V R+F++T L++P  +  + PA S
Sbjct: 40  SVREMIDDFSIVFGVPKYR-TSKPKKVTRKFSFTRLLQPIDNLVTCPACS 88


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,447,450
Number of Sequences: 27780
Number of extensions: 384412
Number of successful extensions: 972
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 929
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 971
length of database: 12,740,198
effective HSP length: 85
effective length of database: 10,378,898
effective search space used: 4379894956
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)