BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_F08_e350_12.seq (1524 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 25 2.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 5.3 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 24.6 bits (51), Expect = 2.3 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 618 TKGNKEKGSLIAAVIDQTDTPVFINEDEEVRKNVWSDIDDELY 746 T G E SL ID+T+T V+I +++ ++ + DD + Sbjct: 185 TTGMGELVSLAVQAIDRTNTMVYIADEKGEGLIMYQNSDDSFH 227 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.4 bits (48), Expect = 5.3 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 513 HRNFWYEYVNHKFNQDIVNGNRND 584 + N+ Y Y N+ +N + N N N+ Sbjct: 326 NNNYKYNYNNNNYNNNNYNNNYNN 349 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 278,448 Number of Sequences: 438 Number of extensions: 5199 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 53352750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -